CAZyme Information: MGYG000002702_00426

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000002702_00426
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1720	MGYG000002702_17|CGC1	189920.12	4.2414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002702	2615547	MAG	Canada	North America

• Gene Location: Start: 10454; End: 15616 Strand: +

Full Sequence      

MKKITRVRHPFKRLLSLLLAFCLCVLQLGVAPGRVAAEAPEVYEPDYSAGGAMGWDVALD
AGVVSELTAQADGSVKAEAFKGHAIDTLSPSMTDGTIEFTVNISSAASFAVLFRAQDQKN
LSALCFDYGNAGGRSMFLQNRIDGTDGDIPLNVVKDPVFGGDMKIKLELAGEAFKLWVDD
VLVLEASGAPVRAGHFGFRIWDGWNKPAPDVTVKDVRVTPAQEQPEDPDREPVGYTPDYT
QDGAMNWDVLLDGGVSSELIVQPDGSLAAEAFKGHAIDLNSPEIADGILEFTVNVSSPAS
FALLFRAEDQNNLSYVAFDYGNGSDPMRLQDRTAGVSKDTDLDSREHLNYGQDTRVKLIF
NGTRVTIYKDGMLVTTAQTGRTGKGHIGFRIWDGPDWGREFPDVVIKDLKLTEIIPQEVE
DDPLEAVVLTTEEMTVLMDNRFPSVYEYQIGGKTVAGQRAQLRTVTLNGAEYYAANVQVT
SRSDNTVEYSLDVLDATAFEPYPAQPEECGVLASLKIGFTAEALKLRMDVLEIAEQGDFL
VRTIAFPGQYFGTVKNSGGYTEAQARMTTLTTAYGGISESSVLLSANPSGSWYGAYAVIH
DDSFAVTMESNVIETTRKVLVETKTEGSDSYMALTNGAWTYRGPGNDDYWGTEELPWAVV
ALTGDCNGDQKVDWQDGAIRYREMAVRPLGSDEMKNYISYIFMNCMSGASMPFMRQLDTI
KTMYNYYDGFGQMILEKGYNGEGHDDVLYDLVGHVNERAGGEEDFQYLLARAKDFNAKIG
VHINVNEYTLDSFFLDDQYLYKPLQGGWGYLDQSYKNNKNLEILEGAMDARMQEFCDAYP
DMGWVYIDVFDGIDWYADKMAESLNRNGLPVGTEYRGPMEKDMVWVHNSTDIHYPVSHPQ
DTPMYRFIKNGWGDIFPPHELLKNLQQPAVGAWEHTTNFNEAVEVFYNNNLATKYMQHQD
IMQMSSTEVVFDRGLRVVKENNASLGLGERVNLYQNGVLIASLPVGNYRPVDNVDRDTYI
NSMIFIPWYAEDSETKDPLDADKIYYWNALGTSSTWELPPSWAGQKAVKLYELTNTGRVF
VKAVPVLDGKVTIEAEKGVPYIVHKADETVVTSDQADNQWGENTLIREPGFDSMNFENWE
VEGDSAVNGFTDRRDSDVKIAGEDASLRQEITGLVPGENYTISVWTDVRGDMTSLLTVRV
GDRTLTDYVGDTSFFVRQERNHKYGYTTYEQLRVNFTVPEDVTGAVIELSAKAGENASSS
DYVRFDDVRAFQSLREVQQSRYTFFEDFENVPENLGPFLYATPGYQSIEQAHLAEKNPDP
EHPQIKNYVVDGRFSLKMNNNALSNARILRTVPSTLRLEPNTTYEMGLDYFTRKDGTYQF
SVKNGAGETIPGSVMVLKAVGEGETGTASVTFTTDGSEDCYVEVYQIGGIADIETEYLSF
DNFYVNDLSSEVSVNHLNRLLEETDGYEKERYTAGSLAQLETARARAVELLKTTGCNIAN
DEVALAMDRLQAAANGLVEISSLQALYDANQDRQQGNYTDSTWKAFQEALAGAEAVLKNE
NASQADVDDALRALQDAVSGLQATDKSALQALYDANKDKQQGNYTDSTWKAFREALAGAE
AVLKNGNASQADVEDALRALQDAVSGLQQKPDESSRPEEPGEPSSSEQPVSSEGGSSAPD
VSSGNEPSTGADGVAGMWLVLLSLSLLCAGGLIFARRRAS

Enzyme Prediction     

No EC number prediction in MGYG000002702_00426.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	432	1105	2.7e-116	0.9957567185289957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12905	Glyco_hydro_101	8.96e-68	675	940	1	270	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
cd14244	GH_101_like	1.04e-64	688	966	1	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam18080	Gal_mutarotas_3	3.35e-42	429	674	1	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	7.16e-28	949	1079	1	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.
pfam17974	GalBD_like	2.69e-18	1266	1443	1	188	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAS61722.1	1.35e-186	231	1647	319	1728
AYE33559.1	1.35e-186	231	1647	319	1728
QQA11708.1	2.37e-177	276	1465	348	1512
AXH51752.1	3.27e-177	276	1452	348	1496
BAG69287.1	4.52e-177	276	1465	348	1512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QEP_A	1.29e-84	429	1434	12	1091	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
6SH9_B	1.32e-84	429	1434	12	1091	EngBFDARPin Fusion 4b D12 [Bifidobacterium longum subsp. longum JCM 1217]
6QFK_A	1.32e-84	429	1434	12	1091	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]
6QEV_B	1.32e-84	429	1434	12	1091	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
2ZXQ_A	1.50e-84	429	1434	27	1106	Crystalstructure of endo-alpha-N-acetylgalactosaminidase from Bifidobacterium longum (EngBF) [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9WNA0	6.06e-95	422	1448	42	1037	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
Q8DR60	6.43e-80	418	1519	323	1485	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1
Q2MGH6	1.47e-79	418	1519	323	1485	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
E8MGH9	7.76e-12	1457	1651	1671	1881	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000362	0.998860	0.000256	0.000188	0.000168	0.000152

TMHMM  Annotations     

start	end
13	30
1693	1715