CAZyme Information: MGYG000002705_01292

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS856
• CAZyme ID: MGYG000002705_01292
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758	MGYG000002705_26|CGC1	85168.39	5.2835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002705	2922707	MAG	Canada	North America

• Gene Location: Start: 23664; End: 25940 Strand: +

Full Sequence      

MEYPILFIRAGAQRNEMDHPVSAPYMRRAFSIKEIPAAAPLEITAAGFYELFINGKRITR
GMMAPYISNPDDALYVDTYDLRPYLHVGENVLGLLLGNGLVNSPNSGPSEFTTARFRAAP
SVALRLQLGETVIQSDASFRTAPSPVLSDDYRGGESYDARRELPGWAEPGYDDSGWAFAE
EAPPPRGELIPNIANPIVVIGERQPVSVERAGDTYLYDFGVNSAGVCRLRIRGAQAGQKI
TLYHRERLWPNGLSEEDSQYKEPDFDYGQTDCYICKGGEMEEWTPRFTYHGFSYVEVAGL
TPEQAAPDALLYQELSTDMRERGGFRCSNAIANAVCDITLRSARSNFQHYLTDCPHREKN
GWTADAALSTENILLFLEPDNNFRQWMQMLRKAQAEQGGLPGIVPTSGHAYTHLNGPAWD
CAVIWVPYYLWKYRGDLAVVRENAHAMLRYLEYLTTRVREDGLVAFGLGDWSHAGRGAWL
FKAPVELTDTVTCMDMCAKAAVLFEAAGRPLQAAFARSFYDQLRAAARKRLLDFQTATVL
GNCQTSQAMAIHYNLFEPGEKSAAFARLVEMIERDGGVMDVGVLGGRVLFHVLAEFGKAE
LAFRLITQPDFPSFGWLIAQGATTLWENFMLPKTKWLDSRNHQFWGDVGHWFLRWLAGIH
YDCPAHRLDIRPQFIEALEYAEGYHLAPEGKIFVRWERAADGIQLDVEVPEGLQGYMFLP
DGYSFEDERYDSGVFVKPAASGRYKLLPYKIEGINRKS

Enzyme Prediction     

No EC number prediction in MGYG000002705_01292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	211	715	2.9e-122	0.9821428571428571
CBM67	15	185	1.3e-30	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.80e-71	320	654	1	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.14e-30	36	200	3	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.38e-25	213	303	6	90	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.33e-06	670	722	14	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	3.26e-133	14	726	134	847
QGA23306.1	3.72e-123	22	721	160	864
AVM44977.1	2.84e-122	23	717	17	701
AHF16194.1	3.92e-121	23	733	172	876
QNE39799.1	6.76e-121	19	720	147	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.27e-91	23	720	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.05e-70	15	737	303	1011	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.71e-64	10	734	118	860	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	1.33e-09	178	726	406	948	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	9.29e-74	17	747	173	948	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.01e-69	15	737	303	1011	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	3.98e-61	25	724	172	883	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	5.71e-59	11	746	165	909	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002705_01292.