CAZyme Information: MGYG000002706_01393

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila
• CAZyme ID: MGYG000002706_01393
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000002706_186|CGC1	39458.67	5.3231

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002706	2498174	MAG	Canada	North America

• Gene Location: Start: 495; End: 1622 Strand: -

Full Sequence      

MRRLSGASRAAGAGTDAPAGPFGPPGLQAGIPTGIPVPVVSALARRGGALLFGAACLALI
GCARPETAPRHFPVPGTEEGTGPGVILHETMTVSRRPARMVRVMSVPRPGLRPDARPDSG
FRPDSASDSGPERASLPAASDAAGSAPVSGGESEPGAKAEEEGAEHVAGNPEGAFPADRE
PPVRERRGPGAGTARTPGEGRLALEPLPVENLLDEMDVYALSPHAAQLALPRMVPPEYVR
QVRQGVIRLPAPEIWQGIILRASERYGLDPKLVEAVIRVESNFDAVAESPRGAQGLMQLM
PETQVWLGVTDPFDPEANVTAGSDYLRRQLDRFGSLELALAAYNAGPGNVERYGGIPPFP
ETQAYVARVLELYRR

Enzyme Prediction     

No EC number prediction in MGYG000002706_01393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	267	374	1.9e-33	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.18e-48	258	375	7	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.52e-45	270	374	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.61e-40	252	375	3	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.25e-31	259	365	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	2.11e-29	259	357	1	113	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM29992.1	2.11e-63	208	371	275	435
ADP88368.1	4.30e-62	210	371	289	447
AAS94339.1	4.30e-62	210	371	289	447
CAJ55223.1	2.88e-57	194	373	57	232
AGC50601.1	2.88e-57	194	373	57	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.66e-11	255	370	416	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.67e-11	255	370	420	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.69e-11	255	370	426	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.70e-11	255	370	430	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.72e-11	255	370	436	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.35e-38	241	373	52	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	6.37e-31	255	375	1422	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	6.37e-31	255	375	1422	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	1.30e-17	255	371	7	117	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	8.40e-15	248	350	282	388	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.357242	0.357152	0.285153	0.000062	0.000378	0.000015

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002706_01393.