CAZyme Information: MGYG000002711_00067

Basic Information

• Species: UMGS856 sp900546265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS856; UMGS856 sp900546265
• CAZyme ID: MGYG000002711_00067
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	MGYG000002711_1|CGC1	64793.99	5.0972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002711	3636319	MAG	Canada	North America

• Gene Location: Start: 97331; End: 99031 Strand: +

Full Sequence      

MKFKLSGGNRNASCTLSEKWEGEILYAALHVVLAEEAVPEKIRVDFMVQGCGCYSVFSPS
VRDFRGPGVNWRRQETHSRLAEWMPLHCLLSRDGRNRLNVTLSEVRLPVGIYTGIREETG
ELECTVEFFTQPTTPITEYQTIIRLDFRQLPYDQSVADSVRWWETACGYTPALSPERARM
PMDSLWYSFHQELSAEEILEECALSRAMGMRTVIIDDGWQTADNSRGYDYCGDWQLCRAK
IPDMQALVHRLHEMDMAVMLWYSVPFMGERSQNYHKFRDKMLHEGVLDPRYKEVREFLTD
TYKRAVADWDLDGLKLDFIDAFTLGEEALKPDARRDYLSLEEAVDTLMQEVKRELTAIRP
DILIEFRQAYVGPAIRQYGNMLRVSDCPADALRNRQDILNLRLTSGRTAVHSDMLMWSPE
ESPEAAALQFASVLYGVPQISVRIKTLPPAHKQMLQFYMNFWMRYRETLLDGAISADSPE
EYYSQARARLGRREVVSVYTDPVVACTAAETVAVNVSPKKALYVKGAAGRRYRVVNCLGE
EIENGIISAPLQEIVVPMSGILFTEE

Enzyme Prediction     

No EC number prediction in MGYG000002711_00067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	184	519	5.7e-32	0.49709302325581395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	5.16e-63	186	464	9	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	2.61e-08	179	321	1	154	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	7.12e-08	186	398	299	515	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	2.00e-06	186	422	8	229	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06597	GH31_transferase_CtsY	8.48e-06	171	345	3	159	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD86820.1	3.13e-148	3	562	9	598
BBI31507.1	1.70e-145	3	561	9	589
QSF42796.1	2.96e-143	2	562	11	586
AZN41080.1	7.36e-143	23	561	38	594
QTH41069.1	1.00e-141	3	562	12	586

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002711_00067.