CAZyme Information: MGYG000002711_00798

Basic Information

• Species: UMGS856 sp900546265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS856; UMGS856 sp900546265
• CAZyme ID: MGYG000002711_00798
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801	MGYG000002711_5|CGC2	91298.12	5.1083

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002711	3636319	MAG	Canada	North America

• Gene Location: Start: 79704; End: 82109 Strand: -

Full Sequence      

MTMEQAAPYLLTPKDRVCRAQSVKYTEGTVRIEPERAYTLQYKEGGDKPYLILDLGRSSP
GGYPVISVKAQKGEPVLRLAYSDWYPYLLDRDHRETGDFLRGCCKYLGVELPVLPANPNR
YELYTLHRTGKYRFPLIQGQQRFVLFTLDTPGDVEIDDFYIYYTADMSDHDGHFLCSRAD
LNQLWYSSTYTVQISSIESAQSWDVLENTLLVRALTKGNPAGIYRKGGDWENYRFTFEGQ
ISVNPDCHSGIGWMVRAADPDNGYVFQAGLDGWLRWYYRKNGVNYPAGEKKLEKPLYDNY
TYAFCTVLQGACMEVFIDGESILQWQDDTYRRGTIGFYQTTEKWAMVSRLEVTSGERLLL
REDFSADPSARYQYTYSRPFLADGAKRDRLPWSGDLDWAGRNVYYAFSDTRYMLESLRMF
ARHQTPEGYIWGVCYPENTEPVKSGEYGYYESDIFSAWFVPTLWDYLLFTGDTEQVSGLY
LTAVRDLDYLWSFVEGDGLFFQRYATSKGLWDHELNDVGKFSYNNIMMYDAFYKGALLAE
ALNDFERFRQFKKRAETMKEGIMRALWREDAGCFMKGYASEEYCHMANCLALAVGILTQE
QAASAVKSLRKWFASHLVMGKIVSLFIRGCFRYGFDQEAYQALTGKTGLSYAGGEPVHVN
WLDSIADENGPATTTECMLYPPSPLTDGKGWGDRSHPDTAVAHLLTGFLLGVEPLTPGFG
QFKVEPHACTLTRAEGIIPTPYGKITAAWRIEDDAFTLEVTHPKEITPVISTRFVSCPTT
CLVVNGCRLTERNESLSCLCG

Enzyme Prediction     

No EC number prediction in MGYG000002711_00798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	380	768	1.1e-53	0.7202380952380952

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17390	Bac_rhamnosid_C	6.82e-11	711	763	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17389	Bac_rhamnosid6H	3.33e-07	383	651	34	297	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3387	SGA1	2.75e-06	374	578	268	472	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
TIGR01577	oligosac_amyl	3.67e-04	463	577	362	468	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
pfam17167	Glyco_hydro_36	0.005	458	615	130	305	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH42040.1	9.83e-250	3	770	1	761
QJD86808.1	2.86e-233	9	797	15	797
ACU72642.1	4.34e-61	37	763	91	817
ABK06922.1	9.91e-55	37	767	95	828
AMU18509.1	6.80e-45	12	801	73	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.03e-12	377	745	326	672	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002711_00798.