CAZyme Information: MGYG000002713_00100

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000002713_00100
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	MGYG000002713_3|CGC1	98183.62	4.8975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002713	2668614	MAG	Canada	North America

• Gene Location: Start: 18427; End: 20988 Strand: -

Full Sequence      

MKIKRLLSAVTAFALIFGMSVQAKISTGSDFKNQTPSELHVEGKYIYNAEGEKVRLTGAN
IPDLQWATGGDNDLDRRIGILLDQWNANCVRLCVHSKFWFGQEWYQNSNYSDYRRKVDDI
IKQVTSRGKYVILNLHEFYAITDQNKRFWEDAAQVYKNNPGVIFGLLNEPHDITWDEWRN
GGKLKTSDAYGEKTIDIYGHQQILEMLRKQGARNIVIAGGLDWAYYLNGIADGYDGLEHG
YRLEEPQGMGGNGIIYDTHIYPMKPEYNPLEKALDCVVDDVPILVGEYGHWGERLFDWYD
NYICEYPHVWMNEIQDYIERNELNYTCWSFHIGASPSMFTDYETFYPTKYSGRYMKYALL
NTPETRPDEKYRRYSDPSPLSTWEKTIDFDTNTADFMVYGDEVRCETDAYGKPDENGNPT
KGLLVAFDRKNSGDWSSAATAELSGDFSGASWLAFNVKGDGDMRKIGIGIELSDGRQFTT
YMPLDLHKNWKNYYLPLDVFKGDYGLLDTDMIKSVMFTSLEEGKGSFTVDNITVGGLPYE
EKAEFTVSDKTEKEQMTWKAWEDDENSYEDSFTYVYDNAQSHSGGTAVKFYYNCPKNSYG
GQARATIPSSWNINDATYFTFWAKGDGTNQKFMLRFEEEKGTNKNEQRSNFKKRELERFC
ISFDVNSTEWKQYKFRISDLGMSDILHMQRLRFISLFNLTLESSGSVVISDFAFTNKGEE
LKADYTSHEKPHKSENITALETKYPENVIMQIPKEFEIEAGTEEHISIHLMNKTDRHVSG
EMSISGLPVDGTANAKYDCYGGYVSYPHYPWRNYSLTNFAVNIPKDKKGIYYITVKDESQ
NGIEPMTYKLTVK

Enzyme Prediction     

No EC number prediction in MGYG000002713_00100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	46	341	5.5e-34	0.8727272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.14e-20	47	329	1	267	Cellulase (glycosyl hydrolase family 5).
pfam03425	CBM_11	1.48e-05	414	537	37	175	Carbohydrate binding domain (family 11).
COG2730	BglC	5.68e-04	116	182	117	203	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT50946.1	0.0	15	853	11	846
QIF03557.1	4.01e-66	23	359	393	727
QDU27947.1	5.87e-63	19	359	391	729
AMV22357.1	8.55e-63	36	367	412	743
ADR64665.1	4.69e-59	35	359	603	909

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HTY_A	4.85e-15	39	359	52	355	CrystalStructure of a metagenome-derived cellulase Cel5A [uncultured bacterium],4HU0_A Crystal Structure of a metagenome-derived cellulase Cel5A in complex with cellotetraose [uncultured bacterium]
4XZW_A	2.41e-13	38	289	11	232	Endo-glucanasechimera C10 [uncultured bacterium]
3PZT_A	3.86e-12	38	289	36	254	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
1A3H_A	1.70e-11	38	329	8	260	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	1.76e-11	38	329	11	263	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07983	7.30e-12	38	289	41	259	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	2.95e-11	18	289	21	259	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
O85465	1.94e-10	38	329	37	289	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06564	6.86e-10	2	224	6	241	Endoglucanase OS=Alkalihalobacillus akibai (strain ATCC 43226 / DSM 21942 / CIP 109018 / JCM 9157 / 1139) OX=1236973 PE=1 SV=1
P06565	1.94e-09	38	329	37	289	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000384	0.998441	0.000330	0.000294	0.000268	0.000239

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002713_00100.