CAZyme Information: MGYG000002713_00871

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000002713_00871
• CAZy Family: PL33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564		64215.24	4.9223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002713	2668614	MAG	Canada	North America

• Gene Location: Start: 11141; End: 12835 Strand: -

Full Sequence      

MRNNLFSEVKDIPQNIQKDKFLQRQLETARSTALEYGEIKSLPYSDFKIFYITGSRSEYE
DKYFAHRRLLDALAIKAAAGDDCINELQDILWAVADEFTWAVPAHIPQGLPVGECVKQID
LFAAETAFTLAEILYIFDEKLDAAVKERIISEVRRRVLEPYLSGIKNSWDERENNWAAVC
AGSVGAAFLYLADDNEIQRVLPRIKATLNCYLNGFGADGVCAEGINYWIYGFGYFTYFAR
LLYNYTNGKENLFDNPKVENIAMFQQKIRFADNKTVTFSDSGDAFIHRSGLSYFLAKNFK
NVTIPDDSSAIGFDGDACYRFAHLIRDFAWRDTEYVKAADNEYGFEYFENSAWYINKTAN
WEFAAKAGRNNESHNHNDIGVFILNTGGQSVITDPGKGEYTSEYFGEGRYGYFAPSADAH
SVPVINGKKQSDGEERFGKISKADDKSLVIDFENAYDDKTLKKLRRCFEFSDNCIKMHDE
LKFSELPSEITEHFVSTAKPCICNDKVIIGDILLKCNMDLFVCEVSEKTFEIGHHKTKTV
YLTDMHIKSPQKSVCAEFSFEINV

Enzyme Prediction     

No EC number prediction in MGYG000002713_00871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL33	362	500	5e-43	0.9602649006622517

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	2.28e-08	344	437	5	97	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM42517.1	1.04e-111	16	561	32	601
AST96161.1	1.04e-111	16	561	32	601
AOZ93188.1	8.52e-111	5	562	26	610
QQZ63874.1	4.67e-106	29	561	49	601
EES71610.1	4.52e-105	25	561	50	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JP4_A	4.28e-07	135	476	153	506	Crystalstructure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila],6JP4_B Crystal structure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila],6JP4_C Crystal structure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila],6JP4_D Crystal structure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila]
6JPH_A	4.29e-07	135	476	154	507	Crystalstructure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila]
6JPN_A	5.65e-07	135	476	154	507	Crystalstructure of the catalytic domain of a multi-domain alginate lyase Dp0100 from thermophilic bacterium Defluviitalea phaphyphila [Defluviitalea phaphyphila]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002713_00871.