CAZyme Information: MGYG000002713_01208

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000002713_01208
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36942.72	5.0801

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002713	2668614	MAG	Canada	North America

• Gene Location: Start: 6358; End: 7347 Strand: +

Full Sequence      

MKKRIAAVITALSVTLSGITALASGAIPDHRGTPMDGIAVGTEQLNKSVKSYSELFKAAG
NQYGVDPNLLAAICMQESSGRNLSYREDGTEYPAWGIMQIEYTNEKSFAQFGLKTTGQAF
TLQDRLDPEKSINYAAWLISRSLISYDCDYLKMIQAYNFGQTVLDRIIAAKGDDWLNERI
NSAKYADNWKYDKYGDAQYIEHVLRYYHNDIEYIGAKVRINGKLLSFEDQYPLVEDGHTM
IPIRAVAEALNAEAEWDHENYTAIIKKGNTVISIPINGHIAYIDGKQSFLDAPSKIINDR
TMVPLRFISEALNADVSWDQDTRTVMVSY

Enzyme Prediction     

No EC number prediction in MGYG000002713_01208.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	66	211	2e-17	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	4.70e-38	235	327	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam01464	SLT	3.48e-12	56	160	1	95	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	1.32e-11	56	207	1	156	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam07833	Cu_amine_oxidN1	1.86e-10	297	329	1	33	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
cd16896	LT_Slt70-like	2.78e-09	52	207	4	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS21301.1	2.85e-21	216	327	556	666
AFH64572.2	3.13e-20	215	325	558	667
AFC32267.1	3.13e-20	215	325	558	667
AEI42662.1	4.21e-20	215	325	555	664
ADI02694.1	2.97e-19	218	328	33	142

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000381	0.998646	0.000247	0.000236	0.000236	0.000204

TMHMM  Annotations     

start	end
5	27