CAZyme Information: MGYG000002713_01262

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000002713_01262
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698	MGYG000002713_90|CGC1	80566.5	6.3388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002713	2668614	MAG	Canada	North America

• Gene Location: Start: 6325; End: 8421 Strand: -

Full Sequence      

MNYLGDKRSVNTDMTDEEKIKKIAYRYMAENPQEEFFMRPCISPVFRTEKNGMLDIDFNK
LYPESKVGDYAYVCTYIFAEMDGVFRAGADMMHGGEIWINKECIAKTTVHDEYEENKRVI
AVNIHKGKNAVFIKAKKTPLGFGVKFGEAYPTWTPSYMYMPFAEYSGYLGIAYSKLYKND
IYKDKSDFPDIEEKAPEAFVKPYLEDNKVFDKAGYVYAVSMIDSECGKETVLEADTSDNT
VFYVNGEKQYSGKGSFSFTVRLKKGKNYIAAEIERDTNSDFLFKCTADNEKLYAGDCVLT
DGEWLFLGVLNKRNNEVIKLSSPYLLKPSENEYWRMGVSDNYLRKLRHAKNYGKWSYPIG
VVLYGLMYAAEYLNDRTMSDYAVNHLFHVTENKAYSDFDTKINGLPSINRELAILGMLDY
CGSCGNALLEAYKHTNPPESFEETAVLIADYIENKQERLENGMFYRGNSAAKTNYMTIWA
DDLYMSVPFLCRYYLKTKDEKYLEDAINQILCFKEKLFMKEKGLMSHVFSLKHNKKTEVA
WGRGNGWTAFALTELLEVMPKEHKHYSKIIDFCNEFSEGILKRQDNNGMWHQVLDDDESY
CETSCTAMFTYAFARGVRRGRLDEKFARAALKGWDGICRTETDTDGNVYGVCRGSAYSFR
TDYYKYELPWVKNDTHGTGIVLLAGTETAKLKKYYKFR

Enzyme Prediction     

No EC number prediction in MGYG000002713_01262.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	349	689	6.3e-86	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.68e-64	354	692	26	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.24e-52	355	691	34	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04434	LanC_like	1.75e-04	380	656	8	271	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04792	LanM-like	0.001	341	523	524	692	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CQR55648.1	2.40e-142	3	696	4	726
QQZ59618.1	1.04e-140	3	696	4	726
QYR20323.1	1.11e-124	3	696	4	746
QAY65054.1	2.79e-123	5	694	8	732
AWI07870.1	7.36e-119	3	694	4	728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	6.56e-39	356	691	81	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	2.42e-29	355	687	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	6.43e-24	354	691	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.47e-23	354	691	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4CE7_A	1.20e-22	479	692	154	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.53e-24	355	693	29	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	3.52e-23	354	691	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	7.23e-22	479	692	161	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.88e-19	479	687	201	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002713_01262.