CAZyme Information: MGYG000002717_00003

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00003
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	MGYG000002717_1|CGC1	78336.4	5.9043

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 8862; End: 10931 Strand: +

Full Sequence      

MLGKHRKIKSLLFGSFLSVTLFMSCMERDASVEVDILSRPNTTAINTNYPGNRAPLKPLN
FIKLPVGDIKPEGWLKKYLLLQKEGLTGKLGEISAWLDKKDNAWLLSGGDHGWEEVPYWL
KGYGNLAYILKDTAMINETKVWIEAAIRSQQADGYFGPVNERKEGRELWANMIMLWCLQS
YYEYSGDERVISLMTNYFKWQMTVPDEKFLKDYWENSRGGDNLYSVYWLYNITGDKFLLE
LAEKLHRNTANWTNDSALPNWHNVNIAQCFREPATYYMLTGDSADLKASYRVHHLVRRIF
GQVPGGMFGADENARLAYIDPRQGTETCGFVEQMASDELMLRMTGDPFWAEHCEDVAFNS
YPAAVMPDFKALRYITCPNQVVSDSKNHRPGIDNGGPFLAMNPFSSRCCQHNHAQGWPYY
IENLVYATPDNGLAAIIYGPCRAQAKVGDKGTVVTLKEETNYPFEESVRFVLEAEENVSF
PLYLRIPAWCKKAKVLVNGAAVKASMEPGKYIRLCRTWNSGDIVTLQLPMSLSVKRWEVN
QNSASVNYGPLTFSLLIEEEYRKVNSAETAIWDSKWQADADVNAWPTYEIYPQSAWNYAL
KLDGNALEQCLKVEKKEWPADDYPFTTRSVPLMIKAKGRKIPSWGIDQYGLCGVLPEADT
PKSEILEDITLIPMGAARLRISAFPVVEQ

Enzyme Prediction     

No EC number prediction in MGYG000002717_00003.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	182	552	1.6e-33	0.7176938369781312

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.01e-137	33	554	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.79e-28	60	551	8	498	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ53767.1	2.10e-174	35	685	17	646
QXQ95199.1	1.12e-173	48	685	43	665
QNQ38172.1	4.47e-173	48	685	43	665
BCL79118.1	5.41e-173	49	687	39	664
CAD5918643.1	8.91e-173	48	685	43	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	7.32e-19	326	555	381	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	9.33e-16	115	555	78	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.82e-13	115	555	78	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	5.77e-12	323	554	334	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.19e-10	323	554	334	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000900	0.014365	0.984670	0.000017	0.000033	0.000020

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00003.