CAZyme Information: MGYG000002717_00005

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00005
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000002717_1|CGC1	90520.35	5.5697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 13355; End: 15781 Strand: +

Full Sequence      

MTMKKTLIALLTSCALASCGSVQEKSDYLYKDVPFTNVHFTDNFWAPRIETIRSVTVPFA
FRKCEDTHRIDNFAVAARLMEGKFNSPYPFDDSDVYKIMEGASYLMAVKKDQALDAYMDS
LIHLIGAAQEPDGYLYTTRTIGGESLHPWAGSKRWENERDNSHELYNVGHMYEAAVAHYL
ATEKRSFLDIAIKNANLLCETFGPEEGKLTVAPGHQEIEIGLVKLYKVTGDERYLNLSEF
FLDARGKYEHDRNSEDQFRNGAYWQDHKPVTEQDEAVGHAVRATYMYSAMTDVAALKNEQ
PYKEAVDKLWSNVVGKKLYITGGIGSTRHGEAFGKNYELPNSTAYCETCASIANCMWNLR
MFMLHGDSKYIDVLERSLYNAVLSGISLDGKEFFYPNVLTCDESGSERSEWFDCSCCPSN
LSRFIPSVPGYVYAVSPKGFYVNLYGASEADIVLNNGKHVKLTQQTGYPWDGKIKLELVP
EAAGSFDVMLRIPGWVNNQPVPSDLYHYASGEKGTVNITVNGRAKEYKVEKGYAVLSGEW
KSGDVIEMDLPMDIRKSEANDKVEADVNHIAIERGPIVYCAEFADNKGAVLNYVLKPETA
LKTVYDDTLFGGVNLLKGYAERIVAEDNFKVIKSVTDSLTLIPYYARSHRGNGEMTVWFT
SDEMILKNQLMERGRITDKVIIGNATSEAAHNLKGKNTHTGGSNTWRDASDGGWFSYTLT
VDAEKPMELVLTYLSTDGGNREFEIFVDDKKVGEQKLRPETYSAWIDKVYPIPAELTKGK
KNVVVKVQALPGMIAGGVFGCRTQKQKE

Enzyme Prediction     

No EC number prediction in MGYG000002717_00005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	38	580	8.2e-210	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.26e-179	37	580	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	9.58e-163	25	663	5	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	0.001	179	264	605	708	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG4225	YesR	0.006	137	268	19	125	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04791	LanC_SerThrkinase	0.008	179	264	99	200	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR74370.1	0.0	3	808	1	807
QJR65776.1	0.0	3	808	1	807
QJR70038.1	0.0	3	808	1	807
QUT86297.1	0.0	3	808	1	807
AII65963.1	0.0	3	808	1	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.54e-220	28	678	5	642	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	3.29e-162	36	658	14	644	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.98e-157	36	658	14	644	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.76e-117	15	658	18	693	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	5.90e-113	37	658	2	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.23e-112	37	658	2	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000067	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00005.