CAZyme Information: MGYG000002717_00008

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00008
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000002717_1|CGC1	92151.23	6.191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 21543; End: 23969 Strand: +

Full Sequence      

MKYIACLLVGTLMSAYTAAEAADAKVVVNPVQPAQRTLFPLTDVRLGDSQFKEIQELDHA
YLLSLEPERLLSWFRREAGIAPEAPAYPFWESEDVWGGGPLAGHIMGFSLSSMSMMYEAT
GDEALKRKLEAMVRGLKECQDAQGDGYLLATINGRRVFEEVVSGHFTTNNPTINGVWEPV
YIMNKIMLGLYHAYLACDLPLAKEVLVKMADWFGNEVLNKLTYEQIQELLVCEHGSINES
FVTVYEITGDKKYLDWAKLLNDEDMLIPAAEQRDVLNGWHANTQIPKFTGFEKVFDYTQE
EKYTRAAQFFWETVVDKHTWVIGGNSTGEHFFPVDQFEKRVTSDGGPESCNSVNMMRLTE
TLYQNYGKMKMVDYYERVLYNHILANYDPHEGMCTYYTSMRPAHYRIYGTQHHSFWCCTG
TGMEAPAKFGKMIYARQGSDLYVNLFIPSELNWREKGVKLVQNTAFPDCNTVDFVVNTNT
DVRFTLNIRKPHWSSTKKLAVLVNGKKMQLFANAEGYVQLDRSWKNGDKVEVELAPQVTL
EYLKGSDKYAAFLYGPVVLAAKVDNNGLEEAYSFRFPKRTVATLEIPMLTAPALIGSLEK
VKKEVSRKSDKELRFECSSKVASTTFELIPFNRIHFSRYAIYFPLYKQMKDYQAAYDQEK
KTILENEMLQKNTVDHVLIQSPLSESDHKLAGVNMDWGEAYGRSWRHASNGGYFMYQMSV
LPDAPQSIYMQFINTDSGARAFDVWVDGHLVTTIDRSKPKDIPDLFYYEIVPLPQELLTG
KKSVTVKLHAKKNNTVGGMFDIRIVKTE

Enzyme Prediction     

No EC number prediction in MGYG000002717_00008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	43	560	1.6e-186	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.89e-176	43	560	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.12e-103	40	631	13	570	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	9.64e-09	586	643	24	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII66949.1	5.09e-300	16	805	14	800
QUT86295.1	7.21e-300	16	805	14	800
QJR65774.1	7.21e-300	16	805	14	800
AII65961.1	7.21e-300	16	805	14	800
QJR53578.1	7.21e-300	16	805	14	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.92e-159	35	806	24	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	6.13e-154	35	726	24	728	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.40e-20	109	566	75	551	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.78e-17	234	567	191	567	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.10e-16	234	567	191	567	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000423	0.998732	0.000244	0.000223	0.000191	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00008.