CAZyme Information: MGYG000002717_00023

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00023
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	MGYG000002717_2|CGC1	59740.49	6.9211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 3786; End: 5360 Strand: -

Full Sequence      

MKKTILAAILSGICSYAFAQPTTHFEIVAEQPLQVMEHFSASDAWSMHIIGKWPQEKQNQ
VADWLFSTENDANGKPKGIGLSLWRFNVGAGSTEQGKASQIGSPWMRTECFLQPDGSYDW
NKQQGQRNFLRLAKERGVGKFLAFLNSPPVYYTQNGLATNTGRDGTLNLKEEHYEDFARF
LANMIKGVEEKDGIKFDYLSPFNEPDGHWNWIGPKQEGTPATKKEIARAVRLISKEFVKE
GIDTEIAICEASDYRCMFATHMTDHERGYEIQSYFSPDSVDTYLGNTPKVLRLISGHSYW
TTTPLSMLRDYRRQLRDTLDKYKVDFWQTETCIMGNDEEIGGGHGFDRTMKTALYVARII
HHDIVYAGARSWQWWRAIGGDYKDGLIREYTDPDLRDGRVEDSKLMWILGNYSRFIRPGA
VRMSIRATDGKGQTIPEGDTDPKGLMCSAYRNVDGQWVMVVINYADREQNFTFHVNDSKV
KSWQGYRTSDKVGEDLLPIDKLKKKQLAVIPARSVITFVSVVND

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	24	519	9.6e-195	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	3.83e-148	25	387	4	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	3.22e-16	109	519	89	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	0.003	419	518	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68226.1	0.0	1	520	1	520
ALJ59968.1	0.0	1	520	1	520
QUT89019.1	0.0	1	520	1	520
ALJ60213.1	0.0	1	520	1	520
QUT88786.1	0.0	1	520	1	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	3.30e-95	25	524	8	500	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
7O0E_A	1.18e-12	34	463	14	386	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	2.78e-12	2	519	7	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7NCX_AAA	3.99e-12	34	463	21	393	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
1NOF_A	4.88e-12	100	489	44	349	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	2.34e-13	37	260	36	266	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	7.23e-13	1	463	1	410	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000992	0.989835	0.008439	0.000260	0.000233	0.000216

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00023.