CAZyme Information: MGYG000002717_00188

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00188
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		89499.29	7.6151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 12126; End: 14459 Strand: +

Full Sequence      

MRAKICLVITSLLLVASNMNAQSIWDRAHLEKVKQSLHQPFFSAAYQELIADADKTLDVQ
PLSVMMKEKTPGSGDKHDYMSQARYYWPDPTQPDGLPYISRDGESNPELNKLDRNRLGAT
AQRVTTLALAWYFSGDEKYAQKATELIRVWFFNKDTRMNPNLEYAQMIPGHNNNKGRCYG
VIDTYSFVEMLDAVQLLEGSKAFTPKDAKQLKAWFGKLLTWILNSPQGQEEARQANNHST
AHDAQVIAFAMYAGNMKVAQEVINAIPQKRIFTQIEPDGKQPHELRRTLAFGYSQFNLSH
LIDIFVMGRKMGISIDNATSADGRNFYKAMDFLVPYVGKQVEDWPYQQISEWDYKQQEFC
KDLYRTGLLNPARKDYMRIAKAHRVIDWKDRFNLLWVEADDVDNAYAFACGQLQFALKCA
AKARKEADNQCKHRVTPRSINKDGTLKMIHPHDWCSGFFPGSLWQAYAFTNDDFWRQQAI
SNTWMIEEAKWHKGTHDLGFMMNNSFGKAYQLTGERSYKDVVLQSAKTLITRYSDKVKSI
RSWDHNRDKWKFPVIIDNLMNLEMLFWATQETGDSIYWKVAVNHANTTMKNHFRPDYSSY
HVVDYDPETGEVRAKQTAQGYADDSFWSRGQAWGLYGYTVCYRFTKDPAYLQQARHIADF
FLGLPNLPEDLIPYWDMKAPGIPNVPRDASAAAIMASALYELRNYVPAEDGKRYQDIANK
MVDSLNKHYRAEPETNYGFLLLHSTGHHPGGDEIDVPLNYSDYYYLEALARKAALKQ

Enzyme Prediction     

No EC number prediction in MGYG000002717_00188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	450	771	3.8e-132	0.9817629179331308
PL38	64	340	6.9e-110	0.985663082437276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	3.34e-93	63	342	1	273	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam07470	Glyco_hydro_88	7.01e-10	433	650	3	215	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89187.1	0.0	1	777	1	777
ALJ59781.1	0.0	1	777	1	777
QDO68113.1	0.0	1	777	1	777
QUU01289.1	0.0	1	775	1	784
QUT65853.1	0.0	1	775	1	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.15e-117	24	396	8	379	Crystalstructure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]
3WIW_A	2.48e-104	435	777	54	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	3.16e-55	436	771	52	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.24e-55	436	771	53	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.17e-54	436	771	53	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	2.77e-110	437	775	59	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	2.85e-59	437	771	50	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	5.70e-58	437	771	53	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	1.77e-54	436	771	53	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	1.34e-48	435	771	12	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000229	0.999110	0.000178	0.000156	0.000153	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00188.