CAZyme Information: MGYG000002717_00241

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00241
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630		71025.24	4.848

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 11951; End: 13843 Strand: +

Full Sequence      

MNLLRKTWMMLVAVMISSCHTETLDIVSPDGDLKVTMELAEENAFGEAAFSVDYKGGRIL
SRSTLGLETDTQKLAGNLKLKSVSAVKRVTDDYRMITGKRSHCVNEASERIYSFENEAGQ
TLEVTFRVYDDGIAFKYGINAAVDEENVIREHTTYTVPKGARRWMQQYDPGYEKFFPLST
DGKLTNRPEVDLWGYPALVEPQDSVFVLITEANIRRGHCGSLLYNGGQCDSYQVRLADKQ
SVGDGLWESPWRLLIIGDLFDVVESTLVTDVSDPSKVEDTEWINPGMVSWIYWAHNHGSK
DYQIVKEYIDLATRMKWPYDLIDWEWDEMGNGGNLQDAVKYALEQGIKPLLWYNSSTSWL
GPGPLYRLNKKEDREKEYKWLSDMGVAGIKVDFFTGDSVATMNYYMDLLEDAVKYKLMLN
FHGATIPRGWQRTYPHLMSVEGVYGAEWYNNNSILTNRAAEHNATLPFTRNVVGPMDYTP
GTFSDSQHPHITSHGHELALPVIFESALQHMPDRPSGYEGLPEAVKHLLSELPTAWDDTK
LLAGYPGVEVVMARRKGDVWYIAGINGTNEPRTLRAPLAAIPVSGKQVSLFKDGTDDRSF
AIEENIPLSDEETGLEIKCLPRGGFVAVIR

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	12	629	5.6e-174	0.993660855784469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	3.00e-87	279	533	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	2.99e-55	28	274	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	1.08e-22	536	630	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60079.1	0.0	1	630	1	630
QUT88912.1	0.0	1	630	1	630
QDO68315.1	0.0	1	630	3	632
QRQ49851.1	0.0	1	630	1	630
QUT44167.1	0.0	1	630	1	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XFM_A	1.27e-90	22	628	13	641	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3A24_A	1.61e-55	27	630	5	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.86e-54	27	630	19	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQ4_A	5.57e-38	26	594	3	619	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	5.57e-38	26	594	3	619	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	1.70e-88	55	628	65	619	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
Q8A6L0	8.81e-55	26	630	25	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	3.04e-33	5	569	4	659	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000186	0.154182	0.845429	0.000065	0.000082	0.000068

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00241.