CAZyme Information: MGYG000002717_00252

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00252
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798	MGYG000002717_11|CGC1	90247.65	6.1939

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 3032; End: 5428 Strand: +

Full Sequence      

MLVATFPDATLHASGRKILFNKDWKFHLGIVANAEQPEYNDSRWRVLDLPHDWSVEPLPF
QKEGITVGPFSRMSEGDIDTGQTVGGEGWYRKEFTLSGDDAGKRIVLYFEGVYNQSELWI
NGKKANFNAYGYTSYKVDITPYLNAPGTPNTIAMKVVNAGRNSRWYAGSGIFRHVWLVKT
EKLYLDKWDTFVDASELQKKDAVIKFSTIIHNEGLQNKSGKIGIKIYSPAGNEVFSTSQD
VLLSEETPVATSFSIKKPELWSVDTPVLYTAEVSLFSNEKEYDKITVPFGIRTLSFSADK
GFLLNGKPVKLKGGCIHHDNGLLGAVAIDRAEERKVELMKANGYNAVRCSHNQVSEHFLD
ACDRLGMLVIHETFDQWQAAKREQDYHQFFDEWSDRDLSASVRRDRNHPSIIMWSIGNEV
AQRADEPEGDLISKRLVGTIRKYDTSRFTTIGSNDFWDRRQFTWDKDSYRIFRNLDVAGY
NYIWWKYESDHAAYPDRVIYGSESYPKEAAQNWNLVEKHPYVIGDFVWTAIDYLGEAGLA
HALYLGEGENNPQFMGWPWYNGWCGDIDLCGDKKPQSYYRDVLWRERPLTMAVHAPVPDN
KKEVVNGWGWPNELVSWNWKGLEGQTLSVNVYSRSPKVRLYLNGKLIGEKETGKENYTAT
FEVPYEPGILKAVNSKGKEEFILKTAGEPAAIRLTADRNTIKACKNDLSYVKIELVDKDG
NVVPDTSLPVKIACSGKGTVIAGGNAAYDDMKSFRSLTPNTFRGRAIAIVQPTEEKGEIR
VTVSAEGMEDASVLIHAE

Enzyme Prediction     

No EC number prediction in MGYG000002717_00252.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	12	543	2.1e-116	0.586436170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.59e-69	17	536	12	505	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.51e-40	88	419	111	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	2.81e-38	24	451	19	447	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	5.12e-36	692	793	1	102	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK09525	lacZ	1.77e-31	12	419	47	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60209.1	0.0	1	795	2	796
QUT88790.1	0.0	1	795	2	796
ALJ60825.1	0.0	2	795	18	814
QUT88193.1	0.0	2	795	18	814
QUT44657.1	0.0	2	795	18	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	2.87e-199	12	795	2	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	6.31e-199	12	795	2	775	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	1.13e-153	18	798	28	821	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	1.35e-145	16	795	2	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	1.65e-145	16	795	8	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.09e-155	20	798	47	849	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.27e-88	20	724	51	746	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	3.37e-52	20	795	31	793	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	1.29e-50	15	779	2	719	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	5.47e-44	40	651	75	676	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00252.