CAZyme Information: MGYG000002717_00278

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00278
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000002717_12|CGC1	28686.23	8.7143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 15752; End: 16522 Strand: -

Full Sequence      

MKRIISVVCVLFSLLSLSAQETYQKETFISSRGDTLPYRLLRPETVKAGEKYPLVLFLHG
AGERGNDNERQLTHGGQMFLNPVNREKYPAFVLVPQCPVTGYWAYMERPASFMPGEMPLD
NPLTPVFQTVKDLLDTYLAMPQVDKNRIYIIGLSMGGMGTFDMAIRYPEIFAAAVPVCGT
VNPARLKAAKQVKFRIFHGDADNVVTPEGSRAAYKALKAVGADVEYIEFPGCNHGSWNPA
FNYPGFMEWIFSQKKK

Enzyme Prediction     

No EC number prediction in MGYG000002717_00278.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	236	6e-29	0.8942731277533039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	6.77e-52	14	254	157	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	3.73e-18	27	235	369	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0400	YpfH	3.44e-13	53	231	19	186	Predicted esterase [General function prediction only].
COG0412	DLH	5.09e-13	25	243	3	210	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
COG3509	LpqC	1.38e-11	15	209	32	208	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS60377.1	3.19e-53	36	256	22	246
BCI61582.1	2.39e-47	18	254	806	1042
QJW99051.1	5.44e-35	23	255	34	240
VTR91196.1	7.11e-32	36	255	43	239
ACR12533.1	1.52e-31	17	254	42	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	1.17e-51	33	255	155	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	2.03e-29	32	256	17	218	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	3.35e-11	50	255	78	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
7JIZ_A	1.04e-07	134	246	112	228	ChainA, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7],7JIZ_B Chain B, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7]
3U0V_A	8.61e-06	48	234	19	213	CrystalStructure Analysis of human LYPLAL1 [Homo sapiens],5KRE_A Covalent inhibitor of LYPLAL1 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY13	1.57e-06	50	234	533	708	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
Q3UFF7	7.84e-06	55	234	25	212	Lysophospholipase-like protein 1 OS=Mus musculus OX=10090 GN=Lyplal1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000340	0.998922	0.000254	0.000160	0.000157	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00278.