CAZyme Information: MGYG000002717_00898

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00898
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
976	MGYG000002717_51|CGC1	111173.61	7.6627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 2009; End: 4939 Strand: +

Full Sequence      

MIYKRSIMKKLFLLLLLACATHTFAQIKVSNRQNSATDFPLHANGKACGIQIDAADYEVV
NKVSHLFAEDLERVTGTKATVSDSKSIKGKETVIIGTLGRNKFIDDLVKKNKLDVSSIRN
GWEQYVIKVVDRPFKGVDRALVIVGCDRRGTAYGTFALSEAMGVSPLYWWSDVPTRKQKA
VYLETTEYASKAPSIKYRGIFINDEGWGITPWAAKTFEPELGDIGPKTYAKVCELILRMK
GNMLAPAMHPGSGAFNKYPQNKVVADSYGIVMTSSHCEPLLFNNVTEWFKDPMGDWNYIT
NKDGINKVLDKRISENGPYENFYTLAMRGIHDSGLVGVTKDNEVRLMEEVLNDQRSILAK
HINQDIDSIPQQFVPYKEVMDIYEKGLKVPDYVTLVWPDDNYGYLKRLSNKDEQKRKGGS
GVYYHISYCGEPHDYLWINTTPPALIYEEMRKAYDTGATRYWLLNVGDIKPGELGMKFFL
DMAWDVESFNFEKTYTYEAEFLATLFGSKYKEDLTDIFDSYYLLAFQHKPESMGWGYEWN
NHQERERIIDTDFSFINYNEAENRMKEYDRIADKSEKIWKSLPKEYQAAYYELVHYPVKG
AALMNKKMLVAQQNRWYARQGRAATNLLADQVKSYQDSLAYYTDHFNSLLNGKWNHMMSI
TPGWTATYQNMPPVENITVPEEADMQIFIPGQDCTYGMGAMHVLPCVNPYTKNSSFIELY
NRGGKPFNWKATVKENWIKLSRSSGKVTAQDRITVSIDWTKVPQGDDITGEIELTSGNRT
KKVFVPVFNPASPTVEELKGFYVEDNGCVSINAGKFHRKVENNGIQIKAIKGLGYENDCV
QLGEATQGVPNMWFTNKSPKAEYDFYSFTGGNATVHVYALPLFPIDSKHDTRYGVMIDNG
MVQWMTTSSREYSSQWRLNVFRNSAISTLNVNVDKPGKHTLKLICADPGMIIQKVVIDFG
GMKRSYLGPNVTYITK

Enzyme Prediction     

No EC number prediction in MGYG000002717_00898.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	38	679	1.6e-231	0.8421807747489239

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.78e-171	191	531	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.89e-47	802	969	2	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd14948	BACON	1.72e-04	728	785	27	80	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV07546.1	0.0	39	974	32	965
ALK86808.1	0.0	39	974	33	966
AYD49386.1	0.0	25	972	23	963
APZ45930.1	0.0	2	976	3	961
AUC19792.1	0.0	2	976	3	961

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	2.71e-169	52	970	27	931	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	1.28e-134	38	684	19	640	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
6NPS_A	1.93e-121	58	973	34	964	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4C90_A	3.17e-118	8	970	12	847	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	2.79e-101	39	683	17	656	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000874	0.596585	0.401728	0.000321	0.000258	0.000213

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00898.