CAZyme Information: MGYG000002717_00930

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00930
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		38864.52	7.8492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 18; End: 1016 Strand: +

Full Sequence      

MGKRLAYHFVDGKHMLHIGKWISYPETFTWNGGLKFAALTNDQELVKLLQNRFELLFTTE
KALLPIMNHVDVNMFGSLPLELYKITKDQRYLDLGLPYADTQWQLPANAKPKEKEWDQKG
YSWQTRLWIDDMYMITIVQTQAYRITGDRKYIDRAAREMVMYLDELQRPNGLFYHAPDVP
FYWSRGNGWMAAGMAELLSSLPEDSEYRPRIMHGYLTMMKSLKKYQSSNGLWHQLLDHSD
CWLETSGSAMFTFAFIKGVKNGWLDAKEYAPAARKAWMGMVKYIDENNNVKSVCEGTNKK
NDKQYYYDRKQNVGDYHGQAPYLWCAVALLEE

Enzyme Prediction     

No EC number prediction in MGYG000002717_00930.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	22	329	2.8e-74	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.01e-51	24	327	29	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.45e-42	24	323	36	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89086.1	1.12e-251	1	332	36	367
ALJ59889.1	1.12e-251	1	332	36	367
QDO68160.1	6.47e-251	1	332	36	367
ALJ59885.1	9.95e-198	1	332	37	368
QUT89090.1	9.95e-198	1	332	37	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	6.80e-36	23	324	81	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	5.39e-30	32	323	49	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.34e-29	32	323	39	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.56e-23	71	277	110	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.55e-21	128	277	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.95e-29	32	323	49	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
T2KPL9	5.29e-17	165	290	219	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
O31521	5.46e-17	30	314	31	324	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	1.79e-16	89	290	131	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	6.96e-13	128	290	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00930.