CAZyme Information: MGYG000002717_00934

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00934
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		43230.65	8.4744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 6914; End: 8020 Strand: +

Full Sequence      

MYKKVFALLFLLSSFQFLTAQTSLLKNFPEGYTPDEIGRRIAYRFVTEKHALHAGKWIGY
PETFYWNGSLKYAAAAKDKALIKLLQARFEHLFTTEKELLPIKNHVDLNMFGSLPLELYW
VTKDERYKELGLPYADTQWEVPADAKPEEKEWAEKGYSWQTRLWIDDMYMITIVQTHAYK
VTNDSKYIDRAAKEMVMYLDELQRPNGLFYHAPDVPFYWGRGNGWMAAGMTELLRYLPKN
HKDRPRIMEGYLTMMKSLKEYQNPEGLWNQLLDDPDCWTETSGSAMFTFAFITGVKNGWL
NAKEYAPAARKAWMSLVTYLTEKNQVREICVGTNKKNDKQYYYDRPRRTGDFHAQGPYLW
CVVALMEK

Enzyme Prediction     

No EC number prediction in MGYG000002717_00934.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	365	8.3e-73	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.06e-50	118	361	84	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.02e-38	32	368	14	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59885.1	1.28e-278	1	368	1	368
QUT89090.1	1.28e-278	1	368	1	368
QDO68157.1	1.95e-273	1	368	1	368
QDH53377.1	6.80e-235	1	368	1	367
QUT26138.1	5.58e-234	1	368	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	7.27e-33	163	360	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4Q88_A	6.11e-24	164	318	141	309	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
5NOA_A	5.26e-23	164	318	158	326	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4WU0_A	9.75e-18	112	359	80	352	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	5.67e-16	164	346	167	358	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	6.99e-18	164	342	201	396	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	9.86e-18	148	326	138	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	9.99e-15	218	316	231	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	4.77e-14	157	345	126	319	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000222	0.999145	0.000169	0.000154	0.000143	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00934.