CAZyme Information: MGYG000002717_00939

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_00939
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778	MGYG000002717_55|CGC1	87960.8	6.4041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 1566; End: 3902 Strand: -

Full Sequence      

MKNIPLLLLLSLVLLSSACQSQSGKVVVANKVSMEAEAFPLSDLRLLPGNPFKHAMDKNG
EWLLDLSPDRLLHRFRLNAGLTPKGEIYGGWESRGVSGHTLGHYLSACAMMYAASGDERF
KERVDYIVKELAECQDARKTGYVGGIPNEDKIWAEVSSGDIRSQGFDLNGGWVPWYTLHK
LWAGLIDAYRYAGSEQAKEVGIKLSDWAVRSFGGLSEEDFQKMLACEFGGMNESFADMYA
ITGNESYLKLARQFYHKAILDPLKEQRDELEGKHSNTQVPKIIGEARLYELTGDKDMHTI
ATFYWDRIVNHHTYVNGGNSNYEHLGKPDCLNDRLSPFTSETCNTYNMLKLTKHLFSWDP
QAAYMDYYEQALYNHILASQNPDDGMVCYSVPLESGTKKEFSTRFDSFWCCVASGIENHV
KYAESVFFQSVKDGGLFVNLFIPTSLNWKEKGMEVKLETQLPADNKVQISFKGKSKEFPL
HIRYPRWATQGIKVTLNGKEEKVTGTPGSYFTLQGEWGTDTQLVIEIPMELYTVSMPDNP
DRMGIFYGPVLLAAPLGTEELQAYDIPCFISDTASIVQSIAPVPGKPLTFTANTTANAQL
PLVPFYTIHGQKHAVYFDRFPAQEWAKKEKEYQALIKKQKELEARTTDHLRIGEMQPERD
HELQSENSRTGDVGGSKYRDAFNGWFSFTAKVDPAQEMHMLCAYWGEDKDKRSFDILIDG
KKFRTVNLNGTHGPKVFEEEYAIPLSFTQGKEKVNVRFQSHPDCHAGGLFGFRMLKKK

Enzyme Prediction     

No EC number prediction in MGYG000002717_00939.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	49	553	1.8e-204	0.9880715705765407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	43	553	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.28e-131	52	607	19	572	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	3.24e-08	565	617	28	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEM13389.1	8.44e-294	14	778	16	780
QIX60435.1	9.99e-283	16	778	27	791
SNV45513.1	5.46e-264	7	776	9	779
ADY34343.1	6.06e-264	7	776	12	782
QXV67708.1	2.29e-263	28	776	20	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	3.54e-171	39	722	28	749	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	9.31e-165	39	722	28	749	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	4.52e-18	65	551	48	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.97e-18	65	551	48	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000039	0.999990	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_00939.