CAZyme Information: MGYG000002717_01066

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_01066
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801	MGYG000002717_65|CGC1	89569.62	7.181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 2606; End: 5011 Strand: +

Full Sequence      

MKKLLVSTLMLATAIGGQAQVKNQSHGYPIDPVPFTSVKVTDSFWGQRLNASREVTIPLA
FSKCEETGRYQNFVNAAHPSDTIKVGGLAFDDTDVYKTIEGASYLLQTYPDKKLAKYIDS
VLVIVAAAQEPDGYLYTSRTMNPKHPHEWAGSKRWEKVEDLSHEFYNLGHMVEGAIAHYQ
ATGKKNFLNIAIKYADCVCCEIGTGEGQQIRVPGHQIAEMALAKLYLVTGDKKYLDQAKF
FLDQRGYTSRTDEYSQAHKPVVQQDEAVGHAVRAAYMYAGMADVAALTGDTAYIHAIDRI
WDNIVGKKYYITGGIGATAAGEAFGKNYELPNMSAYCETCAAIGNVYVNYRLFLLHGESK
YYDVLERTLYNGLISGVSLDGGGFFYPNPLESMGQHQRQPWFGCACCPSNICRFIPSLPG
YIYAVKDKDVYVNLFMSNTSDLKVGGKAISIEQTTKYPWNGDIAIGIKKNNAGQFTMKVR
IPGWVRGQVVPSDLYSYSDGKRLKYTVAVNGEPVQSELKDGYFCIDRRWKKGDKVEIHFD
MEPRTVKANNKVEADRGRIAVERGPIVYCAEWPDNNFDIFSVFMNRNPKFEVVEKPDLLY
GINQLKTGAQILGYDDQGRLTTTDVDLTLIPYYAWAHRGSGAMGVWLPQELSASRPTMPA
TLASESKIDASHKVKSISAINDRLVPKDENDRSMPYYHWWPKQGSTEWISYEFPAEATVS
SATVYWFDDAPWGGCRVPKSWKIYYKDAQGEWQPVTGADRYGIAKGTGNTVNFDPVKTKA
VKLEIILPDRAAAGVYEWEIK

Enzyme Prediction     

No EC number prediction in MGYG000002717_01066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	38	569	3e-209	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	37	569	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.29e-170	29	650	2	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	7.59e-04	221	369	419	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59249.1	0.0	1	801	1	801
QUT89692.1	0.0	1	801	1	801
QDO67740.1	0.0	1	801	1	801
QJR66040.1	0.0	1	801	1	801
QJR70733.1	0.0	1	801	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	0.0	25	654	2	630	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	9.42e-150	36	650	14	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.93e-145	36	650	14	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.04e-111	37	646	2	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.39e-111	37	646	2	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.68e-111	37	646	2	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1
E8MGH9	1.41e-07	690	799	1190	1298	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000656	0.998028	0.000677	0.000240	0.000198	0.000185

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_01066.