CAZyme Information: MGYG000002717_01355

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_01355
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
966		109723.2	6.6714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 190; End: 3090 Strand: +

Full Sequence      

MMRFWFVFMSMFLPVICWGQIIVKETGGGAAFPLVSSHKTVIYYDAGDYGVVEKTACLLA
EDIKRVTNKKVPVSSKKVSSEYAVVVGTVGRNAFIDRLVAEGQLDVSAIRGGWEQFVVKT
IDDPAKGVKKVLVIAGCDRRGTAYGVFTLSEAIGVSPLYWWADVPTKRKSQLYIENINYV
SQAPSVQYRGIFINDEGWGITPWAGKTFDKELGDIGPKTYAKVCELILRMKGNMLAPAMH
PSSGAFNKYPENKLVADSYGIIMSSSHCEPLLFNNVTEWDKKTMGEWNYITNKGGINKIL
DRRVSENAPYENIYTIAMRGIHDAGLVGVPKDKEVSLVEEVIADQRGILKQHVDSPLDSI
PQIFVPYKEVLDIYERGLRLPEDIMLVWPDDNFGYIKRLNNKEERNRKGGSGVYYHISYL
GEPHDYLWLNTTPPALMFEEMRKAYDTGAKRYWLLNVGDIKPGELGMKTFLDMAWDIDKF
NFDNINNHQVDFLASIFGEKYREDIDDIMNSYYHLGFQHKPEAMGWGYEWNNEHAQERMT
DTDFSFANYNEAEGRMQEYDRISDKSEKIWNTLPESYKAAFYELVFYPVKGAALMNKKML
TAQQNRWYARQGRAATNYLADRTKAYHDSIDYYTGKYNSLLNGKWNHMMALAPGWTATYQ
KMPPVTTIDVPQKAEMRVFLPGQDSPLGKITLNVLPCVNPYTRKESFIELYNIGEQAFTW
NAKVSDSWIKLSRQSGTTLLQERIIVSVDWSKVPVGERVTGEIDIISGSNQEKIYLPVFN
PAYPTVGELKGWYVEDNGCVSINPGKFHRKVENEDIKMKVIEGLGYENQCIQLGEATKPV
QNPRRSRQAAKVEYDFYTFNAGSVTVYTYALPVFPVNSERGTCFGIMIDDGLLKYASNNA
KEYSGEWRENVYRNSTINAVTLNIDKPGKHTLKLICSDPGMIIQKVVIDMGGMKRSYLGP
ETTIVE

Enzyme Prediction     

No EC number prediction in MGYG000002717_01355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	31	664	4.1e-232	0.8378766140602583

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.81e-168	182	522	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	5.28e-46	793	961	2	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.003	72	149	52	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd14948	BACON	0.010	714	774	16	78	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV07546.1	0.0	1	965	1	965
ALK86808.1	0.0	1	965	2	966
AYD49386.1	0.0	24	964	30	964
APZ45930.1	0.0	30	966	35	960
AUC19792.1	0.0	30	966	35	960

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	3.18e-159	19	960	4	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	8.81e-137	32	653	20	619	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	4.78e-119	26	684	38	681	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	3.23e-116	20	963	10	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
7PXQ_A	6.02e-106	40	674	25	655	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005667	0.993298	0.000386	0.000220	0.000197	0.000208

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_01355.