CAZyme Information: MGYG000002717_01441

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_01441
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		42502.76	5.19

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 8236; End: 9339 Strand: +

Full Sequence      

MKVMKKLFKTVCCLGMLAAAIGCSQEPKKADNLKDAYADYFTIGCALNMANLNSPEQVSL
ITTHFNSITAENDMKPQPTQPVEGEWNWENADRIANFARENKIGLRGHCLVWHNQTADWM
YRDENGELVSKEVLFERMREHIHTIVNRYKDVVYAWDVVNEAITDNPDAEVPYRQSTYYK
IAGDEFIKKAFEYAHEADPKALLFYNDYNETNPAKRDRIYNMVKSMKEEGIPIHGIGMQG
HYNISSPTEDEFRKAIELYSQVVDNIHITELDVRINTGEQGGQLNVEQTDKELEMTAEAD
AAQVAQYDMLFRVMRDHKNVIRNVTFWNVYDGDSWLDRRHGNRQRNYPLLFDDNLQPKSS
FNKVVSF

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	33	365	5.1e-112	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	3.86e-125	33	366	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	1.07e-114	74	364	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	1.31e-103	64	367	57	340	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59290.1	9.68e-215	10	367	566	919
QDO67768.1	3.89e-214	10	367	566	919
QUT89652.1	2.21e-213	10	367	566	919
QUT46563.1	5.25e-138	4	367	1	360
QRQ47387.1	5.25e-138	4	367	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AY7_A	5.70e-138	28	367	14	346	Apsychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [Aegilops speltoides subsp. speltoides],5AY7_B A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [Aegilops speltoides subsp. speltoides],5D4Y_A A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [environmental samples],5D4Y_B A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase [environmental samples]
6WQW_A	3.95e-108	33	365	6	327	ChainA, Beta-xylanase [Thermobacillus composti]
3EMC_A	1.52e-104	32	365	6	328	Crystalstructure of XynB, an intracellular xylanase from Paenibacillus barcinonensis [Paenibacillus barcinonensis],3EMQ_A Crystal structure of xilanase XynB from Paenibacillus barcelonensis complexed with an inhibitor [Paenibacillus barcinonensis],3EMZ_A Crystal structure of xylanase XynB from Paenibacillus barcinonensis complexed with a conduramine derivative [Paenibacillus barcinonensis]
1N82_A	8.67e-104	32	366	7	330	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
2Q8X_A	4.94e-103	32	366	7	330	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY13	5.92e-123	33	367	33	369	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
O69231	8.61e-104	32	365	7	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	2.41e-100	23	366	2	329	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
P23556	2.92e-88	32	367	16	342	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
P10474	1.05e-87	32	365	44	370	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000320	0.999722	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_01441.