CAZyme Information: MGYG000002717_01552

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_01552
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468		53000.58	6.773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 3382; End: 4788 Strand: -

Full Sequence      

MNIKTLCITGALLLTGISIYAQKKKEVINDSNTPLHLLQPAYKVPYKALTTSEVKTDIDR
VLRYLEKTTPTRVVSEKTGKVITDYNNLPADAQLERGAFRLASYEWGVTYSAMLAAAEAT
GDADYKKYVTDRFNFLAEVAPRFREMLEKNGTTDPQMKQILTPHALDDAGAVCAAMIKAQ
LQDKSLNLYPLIENYLDFILNKEYRLADGTFARTRPQLNTLWLDDMFMGIPPVAWYSQLA
KENQQKYLAEAVRQIFQFAERMWVPEKKLFRHGWVESMQDHPAFHWGRANGWALLTMTEV
LDVMPENHPQRAKLMELFREHVRGLAACQSGEGFWHQLLDRNDSYLETSATAIYVYCMAH
GINKGWLDALAYGPVAQLGWHAVSTQINAEGQVEGTCVGTGMAFDPAFYYYRPVNVYAAH
GYGPVIWAGAEMINLLNKQHPKMNDSAIQYYSTEQKTTAPIFSVTESK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	100	433	2.4e-92	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.59e-97	104	436	29	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.22e-49	104	436	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61441.1	0.0	1	467	1	467
QUT92984.1	0.0	1	467	1	467
QDO69320.1	0.0	1	466	1	466
AII64718.1	9.69e-298	1	464	1	465
QJR54147.1	9.69e-298	1	464	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	6.74e-242	24	464	2	442	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	1.67e-24	102	415	63	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
1NC5_A	5.96e-23	104	432	41	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.42e-22	104	432	31	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	4.60e-21	190	415	133	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.26e-22	104	432	41	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	7.59e-21	217	433	196	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	7.39e-17	197	402	103	305	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.216917	0.640750	0.141022	0.000490	0.000395	0.000408

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_01552.