CAZyme Information: MGYG000002717_01614

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_01614
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		43221.34	7.5468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 7420; End: 8547 Strand: -

Full Sequence      

MKKKLLGVFLFMSLICGSAVAQELPDKKETLKNLVKVNDYFMKKYADYRTPSYNGIIRPS
NIWTRGVYYEGLMALYSIFPREEYYDYTYQWADYHKWGMRNGNTTRNADDQCCGQVYIDL
YNMSSCPEKIRKIRASIDMVVNTPQVNDWTWVDAIQMAMPIYAKLGKLTGEQKYNDKMWE
MYSYSRNVHGKNGLFNPKDGLWWRDADFVPPYKEPNGEDCYWSRGNGWAYAALVRVLEEI
PADELHRADYINDFLAMSKALKKCQRKDGFWNVSLHDETNFGGKETSGTALFVYGMAWGV
RKGLLDKKEYLPVLLKAWNAMVQDAVHPNGCLGYVQGTGKEPKDGQPVTYDKVPDFEDYG
VGCFLLAGAEVYKLN

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	59	373	1.9e-90	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.36e-110	35	374	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.09e-52	41	374	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69334.1	8.76e-285	1	375	1	375
ALJ61451.1	7.62e-270	1	375	1	375
QUT92974.1	3.10e-269	1	375	1	375
QRM98498.1	1.38e-241	1	375	1	379
QUT32919.1	1.38e-241	1	375	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	9.75e-72	4	370	2	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.88e-64	21	370	3	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.49e-45	149	375	152	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	3.17e-16	59	374	35	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.32e-15	59	374	25	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	4.65e-46	1	375	1	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	9.54e-45	149	375	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	3.20e-38	47	375	76	412	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.73e-15	59	374	35	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000625	0.976767	0.021912	0.000245	0.000229	0.000212

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_01614.