CAZyme Information: MGYG000002717_01704

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_01704
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1586	MGYG000002717_137|CGC1	178116.55	6.8494

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 2893; End: 7653 Strand: -

Full Sequence      

MKCLKLIFCLLCLYCSLAEAKGGEVDAQKEVDEITGRLVTTYLEVKVDEDIIAGYASALR
SDGSFPDLDYVTVHEGSFYPAGSHLKRLKSMAVAYRKPGNKYYNSGKLLKQIVAGIDYWY
KVRPKSRNWWFGEIGAPQDYMVPLILLKGKISEKKLLHYSSYLRDLTGNNGHKGKNRTWV
SAVTIHKGCIEDNIELIRTGIESIASTIKIVPEQGDEGIKVDGSFHQHRPQLYSGGYGLS
YVDDIAYYLQLVKGTAFESYFTQEKKDIFINLLMGGHRLLGYRETFDFGAIGRNISRPEG
LSNISPVTLEYMEQNDPERATDYSAWKEHLSGAPFPAPGNKHFWKSDMMVQHGAGYYLSA
KVISTRTNGTEMLNNENLKGYNLPLGATNILTSGKEYEGIFPVWNWNKIPGTTAVQHPDS
ARLEGYLFGRNRFGGGVSNGKNGAIAYEHCYKGVKAKKAYFFMDDVLLCLGTDIASDAPE
EVVTTVNQCLFKGEMVVGKEGGTTSVYKENASAENPAWVYHDKVGYLFPSGGDVTVSSPK
QTGAWKDINISGSGKKISADIFNLWISHGTKAKEGKYAYMVVPDRTLEEFRTFAAAQNYK
IIQNGSVVQAVKLNHQYAVVFYHPGTIDLGEGLTLATDKQVIVYLEQKGTGYDIWAADPL
YSQRKVCLTLNGREVQIAFPEGELTGSTAFTNIATLQPFDLQCEYLSNPLGIDIQQPRLS
WKMGATTPARGRKQTAYQILVASSRDLLDADRGDLWDSGCVNSAESVNIVYGGVPLPAGQ
RCFWKVRFSDEHNHWSAWSTPANWRMGLFAADWVAQWIGSAEMESQSVGGKKVNNVMADP
WFRKTFNMSDIPQDAVIYVASIGYHELYVNGRKVGDAVLSPSVTDHKSRARYMTYDIKDY
LKEGTNVIALWLGTSWAVFPAYQQKNRPAIPMALAQAEVTLSSGKRLQIVSDDTWKTHAS
PNTLLGYWEAHHFEGECYDAALEKDGWNAPDFDDSGWAMAKVYSTDVIVSSDRTEPNRLL
DEIKPLSVQEVSPGVYRVDMGINYAGWFEMQLQGQPGDSIVFQFSEREKDVCSYGIHSIY
KVGPKRKGAFCNRFNYMTGRWVQITGLRYKPELDQIRGWMIRPDYRRSGGFECDIPLLND
IYRTTLWTFENLSLGNYVVDCPHRERCGYGGDALATTRTALGNYQLGAFYNKWMEDWRDV
QDSEGNVPYTAPTRIGGGGPSWSGFCITLPWEFYRQYGDVRILSESFPTIQRWLSFVETK
SQDDMLVRWGGKWSFLGDWLWPDAWPERSAMEKQGKALGDTRETLFFNNCHWIYSLETAA
QIADVLGNEAAASTYRNRASKVRKAVHATFFNPKDNSYVNGYPSYLAIALLVDLPPKHLK
AKVWKRLEQEILVKREGHFWGGITAGSFLLHTLLDNHRNDLIFEMATKEDFPGWGDMLKH
GNGTFFEDWQCRGSGLHSSYLYIGSWFIEALGGIRRPEAGYKEFTIEPWITKDGPKQVRS
HYNSLYGRIVSDWTLEAGVLTMEIIIPANTTAVLKLSGIHPDALKEGEVAWKEAEGVSLH
SQKGNTLSLALQSGTYRFSVVMDEGR

Enzyme Prediction     

No EC number prediction in MGYG000002717_01704.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	1029	1536	2e-121	0.996031746031746
PL8	341	584	1.8e-82	0.9879518072289156
CBM67	815	1004	1.7e-35	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.35e-126	29	659	8	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.66e-89	340	584	1	250	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam17389	Bac_rhamnosid6H	7.96e-70	1126	1471	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.86e-40	852	1018	3	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam08124	Lyase_8_N	2.62e-33	46	302	27	291	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60391.1	0.0	1	1586	3	1588
QUT88602.1	0.0	1	1586	1	1586
QUT74996.1	0.0	696	1583	33	920
BCI64727.1	0.0	660	1583	7	925
QDU88571.1	6.44e-291	701	1580	798	1687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.14e-113	680	1578	16	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.23e-91	704	1580	12	1030	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
1CB8_A	4.87e-88	57	688	33	674	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	8.18e-88	57	688	55	696	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
6GSZ_A	2.84e-71	704	1538	10	848	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.49e-102	704	1578	42	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	2.59e-100	707	1586	41	944	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	9.96e-91	704	1580	12	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
Q59288	4.48e-87	57	688	55	696	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
P9WF03	1.05e-83	708	1584	42	914	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999186	0.000180	0.000147	0.000136	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_01704.