CAZyme Information: MGYG000002717_01763

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_01763
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000002717_146|CGC1	38360.2	7.7198

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 8661; End: 9677 Strand: -

Full Sequence      

MIGDKHLLDVLLENKFNVVAIFSPEHGFRGDADAGEHVSSSVDSKTGVSILSLYDGKDKK
PSKTSMQKFDILIVDIQDVGLRFYTYYITMCRLMDACAEYNKKVLILDRPNPNGHYVDGP
ILDMKHKSGVGWLPIPIVHGMTLGELALMVNGEGWLPGSRKCDLSVIKCKNYTHQTKYQL
PIPPSPNLPNMKSIYLYPATCFFEATPVSLGRGTSLPFQVYGHPNMTGYSYSFTPRSIPG
AKNPPQLNKLCHGVDLSNMSDEEIWKRGVDLSYVIDAYRNLNLDDHFFRPFFELLVGRDY
VRKMIKEGKSADEIKAMWKDDVEKFKVQRKPYLLYDEN

Enzyme Prediction     

No EC number prediction in MGYG000002717_01763.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	5	335	1.2e-110	0.9577464788732394

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	1.04e-169	5	335	14	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	2.73e-86	5	335	60	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59478.1	1.55e-251	1	337	52	388
QUT89479.1	1.81e-250	1	337	52	388
QDO67921.1	4.97e-248	1	337	52	388
QBJ18079.1	1.27e-234	1	337	52	388
QPH58384.1	1.27e-234	1	337	52	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JJA_A	4.13e-212	2	338	35	371	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]
4K05_A	1.43e-46	4	335	43	398	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	1.79e-69	5	335	71	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_01763.