CAZyme Information: MGYG000002717_01856

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_01856
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299		34873.46	9.8201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 4025; End: 4924 Strand: -

Full Sequence      

MSPTNPKNSPSPVKSFFKSVEKKILHNSKHLYFKTVILQKAGAKDILKKYKKANTTKSPI
GSTCPIWICWWQGEENMPDIIKACYASVRRHAGNHPVILITERNYQEYAKIPEYILRKVQ
NKEISLTHFSDLLRINLLKQHGGIWTDSTILFTRDIDSIITPDANFYSCRHVARNSNVAN
GRWTVFFMACGKDNILPAFLLDTFYNYWKNHKRIVTYLFFDYLFAIAYENIPAVTEMIDS
VPLQKISNLSKCLNMPFDENLMEEFRANYGFHKLTYKKQFNMLTPEGKETIYGYLLRKP

Enzyme Prediction     

No EC number prediction in MGYG000002717_01856.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	81	160	6.3e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05704	Caps_synth	5.68e-76	46	295	25	278	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam04488	Gly_transf_sug	0.007	101	160	40	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68060.1	1.02e-178	1	296	1	294
AQR95087.1	4.74e-59	46	296	65	318
QJQ94005.1	6.28e-57	45	297	67	323
AKP76105.1	6.69e-56	30	298	35	308
QUT46540.1	1.92e-49	45	296	65	313

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000010	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_01856.