CAZyme Information: MGYG000002717_02169

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_02169
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	MGYG000002717_209|CGC1	48184.02	4.909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 78; End: 1358 Strand: +

Full Sequence      

MPLAELADVEATIGENFVGKIDETIIWNKSSGRDEIFSMGENGVNLPGFGKNVGVNYAFY
AGSYWPYDKPEDPGYDYFSYKEYLNIMRTAYANHRGFKIRLSVSGGSDWKTVIGNAAKRE
RFTTEMADIVNNDDNLDGVDFDLEWPGYGGQDAAWTNYGKLMTLLRGKLKEGKVLTISPH
TVSYWFPKEDMKSVDYFLFQNYGPAKDHFTYESFPEAYNKFLTWEYPEEKIVMSFAGSTS
KQYNADGSQTNNPPVRIHQVGEIGPDDNYSNGYYFTGTYQTRWRSEQVKKQGFGGIMCWS
LNIDFPDTNHPLSLFKSSAYAISSNVDTLVTKVDMTPTAIEKVKTKNTEFSIYPNPSEGV
TDITIPEGEKGCKLLMYTNSGVLLQTLEISAEGIFRYEYGKLASGYYLLRLLTDSGKQYS
RLLIVK

Enzyme Prediction     

No EC number prediction in MGYG000002717_02169.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	53	308	2.3e-23	0.8378378378378378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	2.73e-18	55	304	26	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	2.29e-11	76	304	46	334	Glyco_18 domain.
cd02878	GH18_zymocin_alpha	2.77e-11	117	202	90	185	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
cd00598	GH18_chitinase-like	2.31e-10	55	202	27	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd06548	GH18_chitinase	2.39e-09	55	304	29	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO70362.1	6.37e-309	1	426	436	861
QUT75436.1	1.15e-88	3	416	419	844
BCI61676.1	2.28e-52	11	416	439	843
AHF11971.1	7.88e-49	10	416	438	841
QFQ12875.1	4.40e-41	4	370	431	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	1.04e-06	99	304	77	290	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999727	0.000320	0.000004	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_02169.