CAZyme Information: MGYG000002717_02382

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_02382
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000002717_247|CGC1	45557.34	7.5937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 3704; End: 4903 Strand: -

Full Sequence      

MKKSRPTIGIVKSRVFLTGTAFVLMACSSGEEFAGHSGKGEEPVITPVLCTSGASEQAVK
VYDFLRENRNKKTLSGTMACPSWNVNEAEWVYQHTGKYPAIAFFDYLSLEYSPCSWIDYS
KTKIVEDWWNKNGLVGAGWHWRVPCVQGSAERHYTPGDGSVDPGTGKRTTTVFSAANATK
EGTWENEVVKADLKKLAGYLKLLRDKRIPVIWRPLHEAAGNIYNYKNGKAWFWWGNDGAE
AYKKLWIYIFNYFKKEGINNLIWVWTTQTKDSEFYPGDEYVDMVGRDMYPAKDEYTTGEY
CFRQYGTITASCPGKLVALSECGNGEQSGKVYHLARISAQWEAGAKWTYFMPWYDYSRTK
ELDSEAFTATSHRYADKDWWVDAMSQDYVITRDQLPSFK

Enzyme Prediction     

EC	3.2.1.73	3.2.1.78	3.2.1.4	3.2.1.8	3.2.1.151

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	52	394	4.5e-81	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.27e-43	51	356	2	285	Glycosyl hydrolase family 26.
COG4124	ManB2	1.04e-12	183	300	154	266	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGY44077.1	3.41e-147	15	399	100	461
AHW58761.1	1.02e-146	45	399	41	370
QRQ58989.1	1.10e-118	28	399	23	360
SCV06948.1	1.10e-118	28	399	23	360
ALJ47537.1	1.10e-118	28	399	23	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	5.23e-120	28	399	23	360	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	2.93e-75	49	395	4	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	6.01e-71	49	395	95	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3WDQ_A	5.26e-56	51	398	36	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	2.01e-29	45	347	141	416	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55297	1.28e-36	1	398	117	464	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	4.05e-35	39	398	146	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55296	5.49e-35	1	398	116	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P49425	1.05e-32	49	399	146	461	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	1.80e-29	42	399	167	480	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000008	0.000130	0.999910	0.000002	0.000001	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_02382.