CAZyme Information: MGYG000002717_02756

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_02756
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	MGYG000002717_326|CGC1	66834.33	7.7363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 803; End: 2566 Strand: +

Full Sequence      

MTKLLFLGTLLFSTMYLNAQTSGHYQEAPNPVAPNPVAPNPVLWSEVKAPQVSWGSTDMR
YKKEEPAAIRGIQKTINLTAWKGEKVSAQLVVWTPETLNNLTFGISDLTSGRESISKDNI
RTSFVRYVMTDELNKDGLGACGYRNSADFDSTLVADVLDHLAPSLMIPANSAQGGWISIR
VPQQAKAGKYTGIVTVKNGDVALSELKLTVTVKNRTLPVPSEWAFHLDLWQNPYAVARYY
KVEPFSEEHFNLMRPLMKLYADAGGKVITASIMHKPWNGQTYDAFESMVTWLKKADGSWY
FDYTVFDRWVEFMMSVGVRKQISCFSMVPWRLSFQYFDQASNSFKYLNAKPGEAAYEEFW
ITMLKSFAQHLRTKGWFGITHIAMDERPMKDMQETLKVIRKADKDFKVSLAGTYHAELVD
ELDDYCITIAERFPAETIDSRREAGKVTTYYTCCTEPRPNTFTFSPPAEAEWLAWHSARE
NLDGYLRWALNSWVKNPLQDSRFTAWAAGDTYLIYPDARSSIRMERLIEGVQAFEKVRIL
KEEFGKKGDKSAVKNIDKALQMFDERNLIEVPAATAVNKAKEIINRY

Enzyme Prediction     

EC	3.2.1.53	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	49	585	8.7e-235	0.9907063197026023

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13320	DUF4091	2.66e-24	481	541	1	66	Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69439.1	0.0	1	587	1	582
QJR63090.1	0.0	1	587	1	582
QJR71689.1	0.0	1	587	1	582
QJR67351.1	0.0	1	587	1	582
QUT87659.1	0.0	1	587	1	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L7R_A	0.0	15	587	11	578	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7R_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_A Chain A, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_B Chain B, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5L7V_A	0.0	20	587	1	563	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7V_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5FQE_A	7.00e-96	53	543	33	545	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQE_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FR0_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5FQG_A	1.06e-94	53	543	33	545	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQH_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000476	0.998681	0.000280	0.000186	0.000176	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_02756.