CAZyme Information: MGYG000002717_02978

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_02978
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1041		117506.8	5.8566

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 1878; End: 5003 Strand: +

Full Sequence      

MKRNAILVCLLSALFTLPGKVVGQSVSSDGKLVYDFAFAPSEGLVNKTEKEYRKEICLNG
FWDFQPVALPQGYVQGKGVAPELPLPQENAWSQTRIKIPSPWNINSFANRDLEGPDHRNY
PSYPKEWEQVKMAWMKKKITVPADWDGQQIKLYFEAVSGYTEVYVNKEKVGENFDIFLPF
SVDITDKVAAGETAEVWVGVRSQSLFENNSTIGRRIIPAGSMWGYHIVGIWQDAYMLALP
KVHVEDVYVKPLVSKNMLELEVTVQNNTEKKADLQIQGNINEWLNLAGTDVNSAPVPAWE
LGQEALKVAPVKVAVPANASTKVVLQVPVSGELNFWTPEQPNLYAVLLSLQAKKQTLDVK
YERFGWREWTLQGTTQYLNGKPYQLRGDSWHFMGIPQMTRRYAWAWFTAIKGMNGNAVRP
HAQIYPRFYLDVADEMGICVLNETANWASDGGPKLDSDLFWEASKEHLRRFVLRDRNHAS
VFGWSISNENKPVILHVYNRPELMPLQKKAWEDWRDIVRANDPTRPWISADGEDDGDGIL
PVTVGHYGDMSSMKHWVEIGKPWGIGEHSMAYYGTPEQVAKYNGERAYESQLGRMEGLAN
ECYHLLANQRSMNASYSTVFNMAWYSLKPLPLGKRDLTTEPDINKDGIFFTEYKEGVPGV
QPERVGPYCTTFNPGYDPNLPLYDPWPMYDAMRAANAPGHPAWSAYAEVDKKQYEAPEAA
PAEKYKEVIFIGGEDSKLKGIMDAQGVKFAAKVTAPARMIYIVDGTYTLSAAEKKSMLAN
IAKGADVWIWGLTPETVNAYNEILPLPVTLDNLKRSSYLPVQKSWIRGLNNSDFYFCELQ
RADASEYSLKGALVEEGDVLLNACKTDWRAWNKRPEEIKTAGTVRSEYECTAATPVFVKY
QNSASCFYISTLKEFTNSEKGYNTLGVILKNAGIDCREIEVKSNEVFFLRDNQLVFPAAV
KDKLVKTADGWTLDIYVFSPRPLDDLLIEPNMPKLTLVVKAKDCQLAINDKTYAAAGQNR
HEATYKELPLLQGWNLSLIHI

Enzyme Prediction     

No EC number prediction in MGYG000002717_02978.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	45	560	6.8e-83	0.5226063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.95e-37	48	498	5	415	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.64e-28	48	526	5	444	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.75e-26	34	489	20	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	2.17e-15	58	526	55	484	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	8.48e-12	58	240	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60852.1	0.0	1	1041	1	1041
QUT88130.1	0.0	1	1041	1	1041
QDO68986.1	0.0	1	1041	1	1041
QRQ48152.1	0.0	1	1041	1	1041
QUT46256.1	0.0	10	1041	6	1037

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	3.36e-26	49	489	32	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	3.36e-26	49	489	31	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
5T98_A	1.94e-21	88	526	51	446	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
3K4A_A	3.57e-21	88	526	38	442	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]
4JHZ_A	1.08e-20	88	526	38	442	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.84e-25	49	489	32	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	3.40e-22	100	486	30	384	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q6LL68	8.84e-20	58	490	49	457	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
P05804	1.37e-19	88	526	36	440	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
O52847	4.56e-19	58	490	61	482	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.998950	0.000211	0.000180	0.000171	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_02978.