CAZyme Information: MGYG000002717_03045

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_03045
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704		81447.21	7.0108

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 1087; End: 3201 Strand: +

Full Sequence      

MKNNILFLLLVLLMPGISGKMDAREVASFNDGWEFKKGPFSKDAMQAVQKWNTDWQEVTI
PHTWNADDMQKKVSAFYEGVAYYRKKCTFPDNMEGKRIFLRFEGVGSCAEVYVNGYLVGT
HKGAYSAFVCEIGAQVKFGEENEIVVKADNASRPDVIPTNHILFGVYGGIYRPVWLIVTE
PCNIVVNDCASSGVYITQKDVSKKSAEVTVKVKVDNATMAPALLELENTVYDMNGKLVKK
HIQSFELTPQGVQNYASHFKLNNPHLWQGREDPYLYKVVSRLMQNGRVIDEVIQPLGLRN
YEVVAGKGFFLNGKRYPMYGVTRHQDWWGLGSALTNKEHDFDLAQIMDIGATTVRFAHYQ
QSDYIYSRCDTLGLVIWAEIPFVNRVTGQEWDNAHQQMRELIRQSFNHPSIYVWGIHNEV
YHPHGYTAALTQSIHDLCKLEDPDRYTVSVNGYGHADHPVNQNADIQGMNRYFGWYERKV
QDIKPWIEKMEQEYPWQRLMLTEYGADANIKHQTEILGDALNWTSPFYPETFQTKTHEYQ
WSIIAQHPYIIASYLWNMFDFAVPTSKRGSVDARNMKGMMTFDRKIKKDSYFWYKANWSK
EPVVYLTQRRNVEREKKETTVTVYSNIGTPKVYLNGRELTGVRKGYTDVHYIFDNVVLND
GKNVLKATVSHQGQEYTDEIEWMYNGERKRTADSLEYEKEHGSW

Enzyme Prediction     

No EC number prediction in MGYG000002717_03045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	603	4e-92	0.6210106382978723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	8.80e-59	24	602	10	596	beta-D-glucuronidase; Provisional
COG3250	LacZ	1.52e-45	24	423	10	410	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.32e-32	54	445	70	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.73e-20	304	600	3	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	5.19e-18	28	179	3	168	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89582.1	0.0	1	704	1	704
ALJ59361.1	0.0	1	704	1	704
AVM52257.1	0.0	1	704	1	704
QRO23471.1	0.0	1	704	16	719
QDO67619.1	0.0	12	704	10	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FN9_A	0.0	23	701	4	682	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5Z1A_A	1.49e-139	19	689	18	679	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]
3CMG_A	8.00e-139	21	689	1	660	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6MVG_A	6.27e-122	24	667	25	643	Crystalstructure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_B Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_C Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus]
6MVH_A	8.41e-119	24	679	25	651	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	3.12e-83	2	700	23	736	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	3.44e-57	24	662	26	664	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.86e-48	18	650	36	706	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	9.11e-48	24	437	3	406	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	4.32e-44	10	639	31	664	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000337	0.998974	0.000244	0.000146	0.000139	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_03045.