CAZyme Information: MGYG000002717_03282

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_03282
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000002717_475|CGC1	46303.38	6.9367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 2795; End: 4036 Strand: -

Full Sequence      

MPANLQGIWHNNVDGPWRVDYHNNINIQMNYWPACSTNLTECMLPLIDFIRTLIKPGEKT
AKSYFGTRGWTASISANIFGFTTPLSSENMSWNFNPMAGPWLATHIWDYYDYTRDRKFLK
ETGYDIIKSSAQFAADFLWHKPDGTYTAAPSTSPEHGPVDEGATFVHAVIREIIQDAIDA
SKVLGVDKGERKQWEKILQQLAPYKIGRYGQLMEWSKDMDDPKDTHRHVNHLFGLHPGRT
LSPITTSELADAAKVVLVHRGDGATGWSMGWKLNQWARLHDGNHAYKLFGNLLKNGTLDN
LWDTHSPFQIDGNFGGTAGVTEMLLQSHMGFIHLLPALPDQWKEGSISGLCAKGNFEVSI
YWKGGKLSGASVLSNAGEPCVIRYNDSVLSFNTKKGRQYEVILAGESLQLVEK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	1	387	3.8e-175	0.538781163434903

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	3.53e-05	106	201	443	548	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUA20768.1	4.29e-269	1	408	419	826
CBW24755.1	4.29e-269	1	408	419	826
QCT76523.1	4.29e-269	1	408	419	826
CAH09926.1	4.29e-269	1	408	419	826
BAD51196.1	4.29e-269	1	408	419	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	2.52e-114	1	383	349	742	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2RDY_A	6.10e-105	1	413	349	783	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
7KMQ_A	6.96e-98	1	384	370	759	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAB_A	1.33e-83	1	383	393	850	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	9.71e-83	1	383	393	850	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	4.13e-92	3	367	412	797	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	1.10e-60	1	362	366	756	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	3.02e-57	1	362	386	775	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	1.34e-34	1	389	363	722	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999883	0.000137	0.000006	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_03282.