CAZyme Information: MGYG000002717_03334

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_03334
• CAZy Family: CBM50
• CAZyme Description: Integration host factor subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000002717_491|CGC1	43413.51	4.3387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 2631; End: 3824 Strand: +

Full Sequence      

MNEKLNIQDLIDLLAEKHGMSKKNADSFVKEFFQLIEEALEKDKYVKVKGLGAFKLIDVE
SRESVNVNTGERFEIQGHTKVSFTPEPALKDLINKPFSHFETVVLNDNTVLEDTPVDNSD
NEDEENAGQKTEEVTAATPEDIETPKEKIENREEAAISEEVTISEAATTFETATSEETMT
SEEEKTETPEEAEVMKTDASTESSTMKYFIGIVVFVVLLCAGAIAYLYSPELFDNLSSEP
PVEKVVDAGTDKPADNTALADSVAVKDTVTVTEADTDTASGSPVAEPVTKKPDAPVVARR
PDPVNTTPVSQTQKTTAQTQKTTGTAYIPDSTSYTIVGTETTYTIKSGETLTKVALRFYG
TKVLYPYIVKHNPAVIKNPNNVPAGTTIKIPKLKKKQ

Enzyme Prediction     

No EC number prediction in MGYG000002717_03334.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00216	Bac_DNA_binding	5.49e-20	6	93	1	88	Bacterial DNA-binding protein.
COG0776	HimA	1.16e-16	4	96	1	93	Bacterial nucleoid DNA-binding protein [Replication, recombination and repair].
cd13835	IHF_A	1.82e-16	8	93	3	88	Alpha subunit of integration host factor (IHFA). This subfamily consists of the alpha subunit of integration host factor (IHF) and IHF-like domains. IHF is a nucleoid-associated protein (NAP) that binds and sharply bends many DNA targets in a sequence specific manner. It is a heterodimeric protein composed of two highly homologous subunits IHFA (IHF-alpha) and IHFB (IHF-beta). It is known to act as a transcription factor at many gene regulatory regions in E. coli. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups). IHF is also involved in formation as well as maintenance of bacterial biofilms since it is found in complex with extracellular DNA (eDNA) within the extracellular polymeric substances (EPS) matrix of many biofilms.
cd00591	HU_IHF	1.03e-15	8	91	2	85	DNA sequence specific (IHF) and non-specific (HU) domains. This family includes integration host factor (IHF) and HU, also called type II DNA-binding proteins (DNABII), which are small dimeric proteins that specifically bind the DNA minor groove, inducing large bends in the DNA and serving as architectural factors in a variety of cellular processes such as recombination, initiation of replication/transcription and gene regulation. IHF binds DNA in a sequence specific manner while HU displays little or no sequence preference. IHF homologs are usually heterodimers, while HU homologs are typically homodimers (except HU heterodimers from E. coli and other enterobacteria). HU is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups). Bacillus phage SPO1-encoded transcription factor 1 (TF1) is another related type II DNA-binding protein. Like IHF, TF1 binds DNA specifically and bends DNA sharply.
cd13831	HU	4.30e-15	6	91	1	86	histone-like DNA-binding protein HU. This subfamily includes HU and HU-like domains. HU is a conserved nucleoid-associated protein (NAP) which binds non-specifically to duplex DNA with a particular preference for targeting nicked and bent DNA. It is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. HU can induce DNA bends, condense DNA in a fiber and also interact with single stranded DNA. It contains two homologous subunits, alpha and beta, typically forming homodimers (alpha-alpha and beta-beta), except in E. coli and other enterobacteria, which form heterodimers (alpha-beta). In E. coli, HU binds uniformly to the chromosome, with a preference for damaged or distorted DNA structures and can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Anabaena HU (AHU) shows preference for A/T-rich region in the center of its DNA binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47016.1	5.42e-198	1	397	1	397
QRQ47699.1	1.53e-190	1	397	1	397
QQA31617.1	2.48e-109	1	397	1	393
BBK88465.1	2.48e-109	1	397	1	393
QUT63421.1	2.48e-109	1	397	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HUE_A	8.73e-11	5	93	1	89	ChainA, HU PROTEIN [Geobacillus stearothermophilus],1HUE_B Chain B, HU PROTEIN [Geobacillus stearothermophilus],1HUU_A Dna-Binding Protein Hu From Bacillus Stearothermophilus [Geobacillus stearothermophilus],1HUU_B Dna-Binding Protein Hu From Bacillus Stearothermophilus [Geobacillus stearothermophilus],1HUU_C Dna-Binding Protein Hu From Bacillus Stearothermophilus [Geobacillus stearothermophilus]
5J0N_I	1.69e-09	9	93	6	90	ChainI, Integration host factor subunit alpha [Escherichia coli],5J0N_K Chain K, Integration host factor subunit alpha [Escherichia coli]
1IHF_A	1.82e-09	9	93	7	91	INTEGRATIONHOST FACTOR/DNA COMPLEX [Escherichia coli],1OUZ_A Chain A, Integration Host Factor Alpha-subunit [Escherichia coli],1OWF_A Chain A, Integration Host Factor Alpha-subunit [Escherichia coli],1OWG_A Crystal structure of WT IHF complexed with an altered H' site (T44A) [Escherichia coli],2HT0_A IHF bound to doubly nicked DNA [Escherichia coli],5WFE_K Cas1-Cas2-IHF-DNA holo-complex [Escherichia coli S88]
5LVT_A	3.81e-09	6	93	3	90	Structureof HU protein from Lactococcus lactis [Lactococcus lactis subsp. lactis Il1403],5LVT_B Structure of HU protein from Lactococcus lactis [Lactococcus lactis subsp. lactis Il1403],5LVT_C Structure of HU protein from Lactococcus lactis [Lactococcus lactis subsp. lactis Il1403],5LVT_D Structure of HU protein from Lactococcus lactis [Lactococcus lactis subsp. lactis Il1403]
2IIE_A	1.39e-08	9	93	51	135	singlechain Integration Host Factor protein (scIHF2) in complex with DNA [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8J836	2.00e-11	9	94	5	90	Integration host factor subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=ihfA PE=3 SV=1
Q2IJA7	2.00e-11	9	94	5	90	Integration host factor subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=ihfA PE=3 SV=1
B4UAP1	2.00e-11	9	94	5	90	Integration host factor subunit alpha OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=ihfA PE=3 SV=1
Q65TL4	3.51e-11	9	95	7	93	Integration host factor subunit alpha OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=ihfA PE=3 SV=1
A7HBJ3	4.92e-11	9	94	5	90	Integration host factor subunit alpha OS=Anaeromyxobacter sp. (strain Fw109-5) OX=404589 GN=ihfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
208	230