CAZyme Information: MGYG000002717_03403

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_03403
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		54803.52	7.1047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 395; End: 1891 Strand: -

Full Sequence      

MKKNILAICSLILAFPLVGQAMQPAISVEKTSKDYPTPDRSKVLAFPGADGAGKYTTGGA
GGAVYTVTSLADDGSEGTLRWAISKKGPRTIVFAVSGIIELQKALKLNNGDVTIAGQTAP
GDGICLKNYTFSIQADNVIVRFIRSRMGVDIKQKGDDAMNGTKAHQNIIIDHCSMSWCTD
ECATFYDNRNFTLQWCIISESLANSIHEKGAHGYGGIWGGQPATFHHNLLAHHTNRTPRL
CGSRYTGRPEDEKVELFNNVIYNYGSDGAYAGEGGSYNFINNYYKPAPFSATKGSFKRLF
TAYADDGKNNNKAGVHGVFYFKGNYMDPTCPKLTDKQKEALYKVNMDNSYGLVIKKDFAT
EKEVLSKKAFDIAEHTSLQPAKKAYKDVLEFAGASYRRDAIDQRIVDETLKGTYTYEGSH
GSTNGMIDQPSDVGGWPEYKSETALVDTDGDGIPDEWEKKHNLNPNDPSDGAKYTLSPEY
TNLEMYMNSLVNHLYPKK

Enzyme Prediction     

No EC number prediction in MGYG000002717_03403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	96	284	4.3e-78	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	4.41e-09	56	294	48	287	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	1.75e-07	98	276	3	175	Amb_all domain.
pfam18884	TSP3_bac	4.98e-05	447	468	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM11671.1	0.0	1	498	1	498
QUT78078.1	0.0	1	498	1	498
QRQ55765.1	0.0	1	498	1	498
SCV08373.1	0.0	1	498	1	498
ALJ48955.1	0.0	1	498	1	498

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XMA2	9.31e-48	43	495	21	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q5B297	1.32e-47	43	495	20	415	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
Q4WL88	2.50e-47	43	495	21	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B8NQQ7	4.74e-47	41	495	18	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
A1DPF0	1.30e-46	43	495	21	419	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000390	0.998690	0.000232	0.000237	0.000225	0.000194

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_03403.