CAZyme Information: MGYG000002717_03710

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_03710
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		41188.52	5.5274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 1779; End: 2879 Strand: -

Full Sequence      

MTWPAAVINIVNEKNASVSGEGTLDCRGKVFWDKYWEMRKEYEAKGLRWIVDYDCKRVRG
ILIERSSDITLKGFTLMRTGFWGCQILYSDYCTIDGLTINNNIGGHGPSTDGIDIDSSCN
ILVENCDVDCNDDNICIKSGRDADGLRVNLPTENVVIRNCIARKGAGLITCGSETSGSIR
NVLGYNLEAIGTSAVLRLKSAMNRGGTIENIYMTEVKAENVRHVLAADLNWNPSYSYSTL
PKEYEGKEIPEHWRIMLTPVTPPEKGYPRFRNVYVSKVKAENVDEFISASGWNDSLRLEN
FYLYAIEAQTDKPGKICYTKNFNLSEITLKTEEKNVIELKENEQSNINFNYVKTSPDHRT
AGNLAH

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	4	309	2.1e-55	0.76

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	7.26e-38	5	221	189	398	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.27e-14	4	221	44	239	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	3.27e-07	18	232	117	302	Probable polygalacturonase At3g15720
PLN02218	PLN02218	5.36e-06	105	231	237	355	polygalacturonase ADPG
pfam13229	Beta_helix	1.33e-05	60	181	2	131	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ48991.1	2.05e-275	1	366	146	511
QRQ55801.1	2.05e-275	1	366	146	511
QNL41127.1	2.05e-275	1	366	146	511
SCV08410.1	2.05e-275	1	366	146	511
QDM11703.1	2.05e-275	1	366	146	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	3.57e-31	14	300	142	417	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	2.74e-23	65	221	197	351	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	2.67e-22	12	250	165	385	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	1.06e-14	59	232	23	197	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
Q9LW07	4.67e-08	18	249	117	319	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
Q9SFB7	8.02e-08	12	221	157	346	Polygalacturonase QRT2 OS=Arabidopsis thaliana OX=3702 GN=QRT2 PE=1 SV=2
P47180	2.09e-07	3	222	83	280	Polygalacturonase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGU1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000099	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_03710.