CAZyme Information: MGYG000002717_03867

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_03867
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		58322.04	5.7012

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 79; End: 1611 Strand: +

Full Sequence      

MFFIGPDFWQGKENPLFIESDNLCAAWRKHAAEKDNLSVRVGRWNIPGTPIVILVDFQPF
FAQKDDIYTDMWNHYQVDSLHAYGDYDEASMFSYAAGKVVESFYRYNLTETDKVIYQAHE
WMTGMGALYLQMAVPEIATIFTTHATSIGRSIAGNDKPLYDYLFAYNGDQMAGELNMQSK
HSIEKQTAHHVDCFTTVSEITNNECKELLEKPADVVLMNGFEDDFVPKGATFTGKRKRAR
AAMLRTANCLLGTDMGDDTLIVGTSGRYEFKNKGINVFLESLNRLNRDKNLKKNILAFIN
VPGWVGDAREDLQKRLKSKEKFNTPLEVPFITHWLHNMTHDQVLDMLKYMGMSNHPEDKV
KVVFVPCYLDGKDGILNKQYYDLILGEDLSVYPSYYEPWGYTPLESVAFHVPTITTDLAG
FGLWVNSLKNQHGINDGVEVLHRSDYNYSEVADGIKDTISAFSAKTDAEVKEIRKRAGQV
AEQALWKHFIEYYYEAYDFALRHAMQRQLG

Enzyme Prediction     

EC	2.4.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT3	2	305	2.7e-107	0.49293563579277866

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03793	GT3_GSY2-like	3.74e-67	33	502	70	589	glycogen synthase GSY2 and similar proteins. Glycogen synthase, which is most closely related to the GT3 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
pfam05693	Glycogen_syn	6.51e-64	2	504	33	586	Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
cd03801	GT4_PimA-like	2.99e-09	115	497	85	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	8.26e-09	159	502	119	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.39e-05	258	457	1	140	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT91862.1	0.0	1	510	44	553
ALJ62401.1	0.0	1	510	44	553
QDO70151.1	0.0	1	510	44	553
QUR42484.1	0.0	1	510	44	553
QUT24401.1	0.0	1	510	44	553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NAZ_A	1.65e-55	42	502	113	635	Basalstate form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_B Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_C Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_D Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NCH_A Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_B Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_C Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_D Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3O3C_A Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_B Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_C Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_D Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3RSZ_A Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_B Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_C Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_D Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae]
6U77_A	1.69e-54	42	502	93	615	yGsy2pin complex with small molecule [Saccharomyces cerevisiae S288C],6U77_B yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_C yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_D yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C]
5UX7_A	2.02e-54	42	502	113	635	Activatedstate yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_B Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_C Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_D Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C]
5SUK_A	2.15e-54	42	502	113	635	G6Pbound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_B G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_C G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_D G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C]
5UW0_A	5.29e-54	42	502	113	635	ChainA, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW0_B Chain B, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW0_C Chain C, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW0_D Chain D, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW1_A Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW1_B Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW1_C Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW1_D Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW4_A Chain A, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW4_B Chain B, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW4_C Chain C, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW4_D Chain D, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_A Chain A, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_B Chain B, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_C Chain C, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_D Chain D, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O93869	3.16e-59	37	504	86	606	Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gsy-1 PE=2 SV=2
P27472	6.70e-54	42	502	93	615	Glycogen [starch] synthase isoform 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY2 PE=1 SV=3
P23337	3.46e-53	42	508	93	621	Glycogen [starch] synthase isoform 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY1 PE=1 SV=3
P13834	7.66e-51	2	504	63	616	Glycogen [starch] synthase, muscle OS=Oryctolagus cuniculus OX=9986 GN=GYS1 PE=1 SV=4
P54840	1.03e-50	2	504	64	616	Glycogen [starch] synthase, liver OS=Homo sapiens OX=9606 GN=GYS2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_03867.