CAZyme Information: MGYG000002719_00460

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000002719_00460
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838		93532.04	4.3377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002719	3080250	MAG	Canada	North America

• Gene Location: Start: 10451; End: 12967 Strand: +

Full Sequence      

MKKLVALLAAFALIFTAPAGMVPAYAAEEQPMMIYVATDGSDSADGSLAHPVATFEKARD
IARTGDGKAVVNIRGGLYEVNDTLTLTEQDSGLTFRSYMDEEVVISGASKVDGSAFKKVT
DEAILNRIVDKSARDKILSADLKSLGITEYGRIKNQGRGTMPDPGFSTALYVDDQMQTLA
RYPNEGYINIDEVIEQGSVPRNDESLKPEDFKGFKIRTNDKRLDQWKNAEEIWVFGYFMH
DWAEADFNVTIDFDDKNTILSDWPSFYGVTENRRMYFFNLLEELDAPGEWYLDRTNGVLY
LYPSQTLQGDTKVELVTNDQTFITIEGAKDISIKGINFQKSLGQGILAEGVENLLIADCE
FSYIMDTVISITGTKCSVVSNHIHDVGSRAVFMEGGDRDTLTSGENVITNNVIERFQQVK
PTGAYGIEARGVGTLISHNVVRECNSIAILYFGNNHILEYNDVSKACMDTSDQGAIYSGR
SWASRGNVIRYNYIHDMSMIDTNTGMTIQGVYLDDMHSSTEVYGNVFYNLVAVTLYGGGR
NNTFQNNIMIDCKEPFRMDSRGLTWMDSGKDSEIRRNLDAVPYQNEIWSAAYPELVNILE
DEPQIPKYNVISGNVSFNTPDYEVTEEVVKYGTMENNITIKDKNNFVDYKNQDFTLREDS
EVYTKLPDFEPIPFGKIGTYEERTGQIGKDSVMLYIGSPRAVAKGTKTLVDPQNQKVQPV
VKDGRTLVPVRFIAESFGAKVGWEENTQTVTVEQGGQTVTLQIGSDRMDVDGAGVTLDVP
AQTIEERTMVPLRAIVEALGKQVFWDDKGLIVVSESEGMIDKEETFLIDELIRSLTIY

Enzyme Prediction     

No EC number prediction in MGYG000002719_00460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	34	341	6.1e-31	0.5370018975332068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	2.35e-32	722	813	1	92	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07833	Cu_amine_oxidN1	1.41e-14	688	752	34	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam13229	Beta_helix	5.64e-11	323	462	3	131	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	7.98e-10	345	547	2	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	6.79e-06	369	577	3	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH28384.1	1.32e-144	35	758	41	802
QNK56945.1	1.88e-84	34	714	40	762
AUP78440.1	8.57e-74	34	678	27	681
QUT84604.1	8.38e-65	141	678	160	719
QIJ77206.1	7.67e-58	223	626	223	623

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999097	0.000174	0.000177	0.000159	0.000140

TMHMM  Annotations     

start	end
5	27