CAZyme Information: MGYG000002719_00596

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000002719_00596
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	MGYG000002719_26|CGC1	93261.28	4.3909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002719	3080250	MAG	Canada	North America

• Gene Location: Start: 3145; End: 5649 Strand: -

Full Sequence      

MEWIAAIVVFIFALSVTGFTVHADRPGVVQLFVAPDGNDESDGSITGPFATLEKARDTVR
LLGKPAVVNLRAGVYRLSTSFLLDERDKDTVYRAYRQEEVILTEAVDISLDQFHPLADET
LKKRLSDPAVAEHVLVADLKAFGIRELGTLKITGQGNFYPDTGYPPVLYADQQRLTLARY
PNEGYLPIDEVIEEGTILKWSGEADSPPDPSVKLEGLCIRVKDTRLENWKQAGDIWAFGY
FKHDWAESNLPVTVKDDGEVVSSFPSIYGVDQGQRLYFYNLFEEIDQPGEWYLDRETGLL
YLYPPENVESVSFVADEYPFFVLDGSSRITIKGLRFEKGIGNGIKIRHAQEVTVADCIVS
LVSNDALVIDNSVECEAVNNIICDVGASGIVICCGDRKTLTSGDTQAVNNTITRFSQIRT
TYTPGIDLQGVGNIASHNQISDAPHFAIRFGGNDHTIEYNDISKVCTDTVDSGAIYAGRD
WTCRGNRIRYNYIHDMKLPECNTGFKIHAVYLDDMFSSAEVFGNVFYKIESVALFGGGRN
NVFSNNLMIACNMPFRQDERGLEEWYTPKRQETNFASLDRVPYKEGIWAQKYPELVSIVE
DEPLLPKYNKITNNVLCQTPDMNIAQSAKDTGTVKDNVRITDTKSFADYQNQDFTVLNNS
EITRLLPGFEPIPFREIGLQEIGDMEKQAVVLLPGSPLAMVKGEVMWLDADNQKVIPVVE
QDRTLVPLRFIAEAFGAAVAWENDTVSIRLAGRDITIRPGCDYMQVDGHDIALDVPAKIM
QERTYVPLRAVGEALNKEVFWDDSGLIVISDVSDLIDEDDRFTIDALTRRVTMQ

Enzyme Prediction     

No EC number prediction in MGYG000002719_00596.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	30	308	3e-21	0.4648956356736243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	1.70e-25	720	809	1	92	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07833	Cu_amine_oxidN1	1.85e-11	690	750	38	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam13229	Beta_helix	9.88e-11	342	546	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	6.59e-07	325	413	53	135	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	0.003	323	411	74	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH28384.1	3.96e-140	29	680	38	727
QNK56945.1	7.05e-85	20	681	28	733
AUP78440.1	1.03e-62	30	680	26	683
QIJ77206.1	4.51e-52	216	628	212	625
QUT84604.1	1.03e-51	124	678	138	719

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007897	0.990762	0.000555	0.000249	0.000249	0.000266

TMHMM  Annotations     

start	end
5	23