CAZyme Information: MGYG000002719_00861

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000002719_00861
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38359.03	5.2143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002719	3080250	MAG	Canada	North America

• Gene Location: Start: 5542; End: 6573 Strand: -

Full Sequence      

MQDKIQKIIAGMKGIQSGMNETCPIGIISMENWEWTQGVALFALFSYYRKTKDPALLEYL
TGWFDRQIKKGLPDKNVNTMCPMLTMAYLYEETGNAAYLPFLEEWADYAVYHMPRAGEGA
IQHVVSGHANDGQIWDDTLYMTVLFIAKTGVLLGRQEYVDESIYQFLVHIKYLTDPKTGL
LFHGFTFRGRHHFAGALWGRGNSWYTAGLVDYLEIVKLPASVERFLLAGLKTQVNALVER
QDAGGLWHTLLDDPDSYLETSASAAIGYGILKAVRKGYLPASYKAYGDKALSGVLSMIGE
DGTVDGVSYGTPVFERLEDYKKIEVCPMPYGQSMALMLLAEAE

Enzyme Prediction     

No EC number prediction in MGYG000002719_00861.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	342	5.5e-99	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.23e-103	33	342	34	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.31e-92	33	343	27	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDS22765.1	3.77e-156	1	341	9	349
QGQ98394.1	1.28e-155	1	341	9	349
AIQ43751.1	1.62e-151	1	342	9	350
QUL58446.1	5.37e-150	1	342	9	350
QYR23849.1	8.13e-139	19	341	9	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	3.12e-102	33	341	66	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.38e-100	33	341	65	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	5.29e-93	4	341	11	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	1.99e-28	31	296	21	300	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.12e-14	154	311	221	378	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.27e-63	33	341	29	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002719_00861.