CAZyme Information: MGYG000002719_00994

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000002719_00994
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000002719_57|CGC1	40810.09	4.8208

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002719	3080250	MAG	Canada	North America

• Gene Location: Start: 4938; End: 6017 Strand: -

Full Sequence      

MRCETMLDERGVMKIWESEGQPWKERRQELIKILLDEEYGYFPAESVRVTYETVSEEEAF
CASKYPLKKIMLRAELASGVHEFPFYTMIPKGEGKYPFFIHINFRDDVPDRYMPVEEICD
NGFALLSFCYTDVTSDDNDFTNGLAGVLYPGGKRESADAGKLRMWAWAASKILDYACGLE
ALDTGCATVVGHSRLGKTALLAGALDERFFCAISNDSGCSGAAITRDKTGERIADICRLA
PQWFCENYYKYAGKESELPFDQHFLVAAIAPRMVCVGSAREDSWADPDSEYLSCVAANEV
YHRLGLRGFVHPDRLPETGDAFQEGEIGYHLRGGTHYFSREDWLRYMDFINKKREKRSE

Enzyme Prediction     

No EC number prediction in MGYG000002719_00994.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	22	352	1.6e-69	0.9144981412639405

CDD Domains     

MGYG000002719_00994 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	1.91e-120	20	354	26	361
ALL53565.1	1.72e-88	23	352	31	357
QOV20253.1	2.53e-82	23	349	31	354
QTN32611.1	2.06e-73	25	352	87	422
AEV29352.1	1.63e-67	7	355	14	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EHN_A	7.81e-50	115	351	160	396	Structuralinsight into a promiscuous CE15 esterase from the marine bacterial metagenome [unidentified prokaryotic organism]
6GRW_A	6.79e-48	114	351	156	394	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	9.97e-48	114	351	174	412	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	1.39e-47	114	351	185	423	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	2.73e-47	114	351	174	412	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	8.78e-49	115	351	188	424	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
P0CU53	2.44e-18	121	322	147	367	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
B2ABS0	2.83e-17	23	305	141	412	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
P0CT87	4.97e-17	122	322	213	432	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
D8QLP9	1.52e-16	20	306	51	325	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002719_00994.