CAZyme Information: MGYG000002719_01139

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000002719_01139
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652		74231.73	4.4887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002719	3080250	MAG	Canada	North America

• Gene Location: Start: 5789; End: 7747 Strand: +

Full Sequence      

MKFVRLFWTFLLCFVLLRANVISVQAYEFPSAFWPANDRYIQAVEQGNNQEIIDSVNQIV
GILKDEPETTEVMNVMGSRLEQLCLAYERMGQHAATVDYYRRYLYYAQKMGWADAVKIAN
AKLLQYEPEISLYTASGMPQTYFGAPGEPELGVLHGVTSDGINDMPNESMVLLYHEFGDP
ETGWMEAVFKEAAFKNLAVEFAWNLPGQGGQVSDVTQQTDHIIQILSVVEKYNSVPVYIR
FGAEVNIWGTRADPQGYQEAFRHVANLARQYTTNTAMVWSVNKVSSWDIEMDDYYPGDEY
VDWVGVSCYSGKYFLGRNDWPEKEKFNEVVFQTGDNADPVRGMREVITKYGGRKPIMLAE
SGASHTIQSLGEDATGWATLELERMYHYIPMVYPQVKLIAYFDKTIESEVNDYALTSNQQ
MKDSYKELVAQPQFIQNRWDGKASISFRKLDQSIPIDQSSRLLPVYAYVHTYGVQQPRVS
YYIDDVWVAGSNQMPYHVDLNLGWYPPGSHILRVVAEDQNGRLLTETSYTLQVDSGSGSL
PIILDDQQVVTDVPPVTYADRTLVPIRVISEALGFRVDWDEDTQTVTVRDSFKKLSLKIN
SYTAQVNGEDTMLDAPPKVLDDRTLVPIRFISEVMGYHVYWEENPSAVRILS

Enzyme Prediction     

No EC number prediction in MGYG000002719_01139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	214	378	2.6e-23	0.45874587458745875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	1.72e-32	558	650	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07833	Cu_amine_oxidN1	7.95e-13	538	588	43	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
COG4124	ManB2	4.04e-05	215	310	156	257	Beta-mannanase [Carbohydrate transport and metabolism].
pfam02156	Glyco_hydro_26	3.88e-04	235	362	151	284	Glycosyl hydrolase family 26.
PRK14696	tynA	0.006	563	634	1	72	primary-amine oxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ39775.1	3.52e-69	16	521	16	523
ALS21301.1	1.41e-60	87	652	107	668
BAD39558.1	1.71e-59	77	652	12	588
AUO19576.1	2.61e-56	133	650	54	579
AEI42662.1	2.70e-55	198	650	235	666

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000190	0.999241	0.000152	0.000144	0.000134	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002719_01139.