CAZyme Information: MGYG000002719_01597

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000002719_01597
• CAZy Family: PL33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222	MGYG000002719_136|CGC1	25020.22	6.0237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002719	3080250	MAG	Canada	North America

• Gene Location: Start: 6241; End: 6909 Strand: -

Full Sequence      

MTAHEREDGEGFALAAKGAHNNESHNHNDVGQFMVYYGGKPVLIDMSVGAYTKKTFSPQR
YEIFTMQSAYHNLPTINGVMQKDGRKYAARVLDYQCNASETRLLVSLKDAYPPEAGIESW
EREFKLNRKESYVMVTDTFAFADEPGDICWNLISCCQPDLADGRIGECRVRYDGCPVTAS
AEEIRGDDVFMKKWGGPVYRTCLQMNGKTQKGRFSLKIEPAE

Enzyme Prediction     

No EC number prediction in MGYG000002719_01597.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL33	11	163	5.5e-59	0.9806451612903225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	6.79e-10	15	152	29	164	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD87610.1	1.63e-47	1	218	398	624
BAV08307.1	3.77e-43	10	200	431	631
QNI36871.1	6.12e-43	1	218	445	673
SOE23355.1	6.31e-43	10	220	415	638
QHS59822.1	7.01e-43	11	218	427	647

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002719_01597.