CAZyme Information: MGYG000002719_01754

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000002719_01754
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677		77497.55	6.709

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002719	3080250	MAG	Canada	North America

• Gene Location: Start: 1132; End: 3165 Strand: -

Full Sequence      

MWYETSYRRHLCDMHIEDWNDDFLSKFSPEDYFENLKRANIQNAMLYFQSHVGYCYYPTA
SGHMHNAFLGDEGKMRRLVNLCRDNGIRVTGYYSLIYNTWAHDTYPQWRMVGRDGRSQRE
AIRKKGQTVSAGEAAKQRYGLCCPNNKDYRTFVFRQIDEIMDYFTFDGMFFDMLFWPHFC
YCESCKKRWEKEVGGKLPADEDWSDGRWRLHVAKRREWLGEFAQTVTDYVKAKRPRVSVE
HNFASGVLPGWHLCAAEGVNNACDYTGGDLYGGILEQSFTCKFYRNISRNQPFEYMFSRC
HPNLQSHTVTKSEDMMKTAVFLTLAHHGATLVIDAIDPAGTMDERVYERIGKVFASSKPY
EPYLKGEMIEDVGVYYSLRSKFNGQGDGYTNHTCCVNAVKTLIENHVSVGVTGGYHDLSK
YKVLVVPSLTEEDAYDNERILSFVREGGNIYLNGGGNRPLVEELLDAKVCGYTKESKTYL
APRAGAEGVFGDFNRKYPLSFDGRAALLTGTGEEGVLATLTLPYTAQNEFTYASIHSNPP
GVATEYPAVVTKQFGKGRVIWSAVPVESSIIWEYKQIFMQFIDRLLSQRSIQSNAPRTVE
LTAFKEAGAITVSAVYLNEEYFADTIKGFEIRVRSDRPAKTVFLLPEKTPVDTCYQDGFV
CFEARDLHIYDQYKIVF

Enzyme Prediction     

No EC number prediction in MGYG000002719_01754.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	29	173	6.5e-28	0.9847328244274809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	1.51e-09	28	173	1	135	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
pfam08532	Glyco_hydro_42M	1.05e-04	400	577	37	200	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	0.001	401	452	34	85	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
COG1874	GanA	0.006	100	449	97	486	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH23071.1	6.03e-145	1	658	1	658
BBD45930.1	3.04e-119	1	607	7	623
QNK60153.1	9.04e-116	2	670	5	685
AVM44410.1	1.16e-81	7	602	17	610
BBH24081.1	8.35e-46	307	620	19	340

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002719_01754.