CAZyme Information: MGYG000002721_00986

Basic Information

• Species: CAG-873 sp009775195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp009775195
• CAZyme ID: MGYG000002721_00986
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		63676.67	5.7761

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002721	3174810	MAG	Canada	North America

• Gene Location: Start: 20558; End: 22282 Strand: +

Full Sequence      

MKKQIGLLTLLCAALLPGSADAGIARTPVAPTRIVWMSDTTGNYIKNPEILMKDFAGQVS
VADNSCTVMRSDTKHQAAVLVDFGKELHGAIRISSGMRASTRPLKLRVRLGESVSEAMSD
VSPDCNPQNATNEHAMRDFELQVPWLGSIEYGNSGFRFARIDLLDQDVDYLLRNIQAISV
MIDDPMVGSFKCSDDRLNKIWETGAYTVQLNMQDYLWDGIKRDRLVWLGDLHPEVMTVSN
VWGKHDVVRRTLDFGKADTPLPGWMNGFSSYSMWWLLIHRDYYLYNGDLAYLRENQDYIL
GLTRQLDECVDANGEEKMTGVRFLDWPTSEQQDVIHDGLQALTYMTLKAVGQIAGWLNDK
EMASIASNCLARMDKYNMKHTDASQAISLTLLSGTSKDVKGDCGKLIANGIESFSPFYGY
YAVEALAESGEIDTAMKMISDYWGSMIDLGATTFWEHLNYPDTKIAGRIDEIVPANKYDI
HGDGGAYCYIGFRQSLCHGWAAGPTPWLQRYVLGVKPVEPGCKTVEVKPHLGDLAYAEGT
VPTPYGPLAVKAHKDASGKTVCSVKAPKGVKVIK

Enzyme Prediction     

No EC number prediction in MGYG000002721_00986.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	76	571	3.6e-94	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.03e-18	185	512	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.68e-06	514	571	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41829.1	6.50e-278	3	455	4	456
BCI61840.1	6.03e-246	9	574	11	574
BBD46130.1	1.95e-233	24	574	38	588
SCM59046.1	1.51e-220	24	574	38	588
CEA16344.1	2.00e-220	24	570	43	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	8.28e-43	76	569	191	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	3.64e-30	155	572	504	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	2.38e-18	78	513	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000226	0.999079	0.000196	0.000172	0.000153	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002721_00986.