CAZyme Information: MGYG000002721_02100

Basic Information

• Species: CAG-873 sp009775195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp009775195
• CAZyme ID: MGYG000002721_02100
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000002721_24|CGC1	69216.75	5.1619

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002721	3174810	MAG	Canada	North America

• Gene Location: Start: 240; End: 2063 Strand: -

Full Sequence      

MKKIFVAALSALLGIVNTLAAEWQVRTAYAGDIKVICQQPGGWKFELHVDSIDGKEILAV
GLTSDSLRLPPRFDVIISVPQLDIHHLWRPGDMDRCQLRPEWMGYYSSHLAFDMPLYAFI
NSNNGNRLTVAASEPLRNIDAQFGLVEEGCTLLGKLSYFNGPQTQMTHYETKIMLDSRPV
MWSEAIKEGAEWMTSEAGLESVAAKEEAFDPLYSTWYNFHQNVTADRIERECLEASRMGM
KTIILDDGWQTDDNNRGYAFCGDWQMSHNRFPDFASHVKRVHDMGMKYMVWYSVPYVGKK
SRNYERFKGKYLSESAEVCVLDPRFPEVREFLCSTYENAMKEYGLDGFKLDFIDSFRFDN
EDPAEADNYAGRDIKSLPAAIDILMKEIYRRLSAINPDVLIEFRQRYMGPAMRQYGNMFR
AGDCPADLQSNRQRIANLRLTSGESAVHSDMLEWNLSETPENAARHILSALFGVVQYSMM
LGELPENHTKVIKHWLDFSQKHRETLLKSEFRPYHPEKCYPVIEAESDEELIVAVYDGMS
VPEMKTSGKSTYIINASGTPSLVLDMPATPRRVVAYDVYGCETTAPEIVKGVQRVAVPLS
GYLQIEY

Enzyme Prediction     

No EC number prediction in MGYG000002721_02100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	204	541	1.7e-33	0.501453488372093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.71e-60	211	498	4	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.23e-16	212	508	44	346	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	1.71e-14	211	352	3	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06591	GH31_xylosidase_XylS	1.05e-09	262	436	56	239	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	2.06e-08	219	451	269	509	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	2.41e-179	41	607	17	587
QTH41069.1	1.92e-144	41	603	17	586
QSF42796.1	2.55e-144	48	606	29	589
QUO31288.1	2.30e-143	80	605	56	583
QGQ97599.1	8.53e-142	53	565	31	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	6.27e-10	212	402	332	516	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	3.84e-09	212	402	332	516	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q5ARP5	3.13e-08	212	351	329	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
P0DTR5	8.69e-06	206	353	307	465	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.999092	0.000169	0.000155	0.000150	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002721_02100.