CAZyme Information: MGYG000002731_01006

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000002731_01006
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		55492.88	4.5482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002731	1087449	MAG	Netherlands	Europe

• Gene Location: Start: 79; End: 1527 Strand: +

Full Sequence      

MANIKFPEGFYWGGATAANQFEGAWNVDGRGPSVDDHFLGGSYKEPRQITIDIDPNRFYP
NHDGIDFYHHYEEDIALFAEMGFNMFRMSISWSRIFPNGDDAEPNEAGLAFYDRVFDCLR
AHNIEPLVTLSHYEMPYHLVEKYNGWASRELIGFFEKYCQTVFDRYQDKVKFWLTFNEIN
CGTQDMGNLFETSMIQGFEGPASAVHTTPQARMQALHHQFVASGRVVRYAHEHYPQFKMG
NMDCFILSYAATCDPADVFATQQEMNTMNWYCSDVQVRGKYPFYAKRFWAENDVELVMED
GDLQDIADGKVDFYTFSYYMSGTVGTHKDHEMTEGNMTFGGKNPYLESTDWGWQIDPLGL
RIALNEIYARYEIPLMVVENGMGAYDEVEEDGSIHDQYRIAYLQSHIKAMGEAIADGVDL
IAYTWWGPIDLVSAGTGEMRKRYGFIHVDKYDDGTGTYERRRKDSFFAYQKIIKSNGTEG
LD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	477	7.3e-147	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	6	479	4	472	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	5	479	3	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	6	479	6	476	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	5	479	3	475	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	6.86e-178	1	477	1	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54543.1	0.0	1	482	1	482
AZH68836.1	0.0	4	482	1	479
ADK67798.1	1.50e-300	6	482	5	480
AEB07548.1	1.67e-288	5	482	4	481
QOY59935.1	5.51e-275	6	482	5	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.84e-169	5	477	7	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	2.10e-168	1	479	3	478	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	6.03e-158	2	479	3	479	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.72e-157	2	479	3	479	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	7.06e-156	6	477	20	482	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	1.15e-167	1	479	3	478	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	3.06e-165	5	477	7	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	4.59e-162	1	479	1	478	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q48409	1.19e-158	6	477	4	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46130	1.61e-158	3	477	4	468	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002731_01006.