CAZyme Information: MGYG000002737_00150

Basic Information

• Species: Prevotella sp900553465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553465
• CAZyme ID: MGYG000002737_00150
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000002737_2|CGC2	40437.76	5.8472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002737	2443712	MAG	Netherlands	Europe

• Gene Location: Start: 55099; End: 56178 Strand: +

Full Sequence      

MRKILFTAIAAIVALCADAQNSTPAAELLARMERIQWRGVMMGHQDDPMYGTTWKYEAGR
SDVKDVCGDYPAVMGFDLGKIEYGSERNLDGVPFSLMRDEIRAQHERGGIVTLSWHPGNP
ATGGNSWDAKGRAVGKLLPGGSLASVCDEWLGRVADFIGSLKDKDGRRIPVIFRPWHEMN
GAWFWWGCDSCTPEEYRRLYIHTHDFLTARGLDNIVWAYSPNLSNGTPTEESYLLYYPGD
RYVDLLGTDVYQQSADNASYRADVRKELKVVTAVGRSRGKLTALTETGHRGVPYERWFTE
CLLPVITEFPISYVLLWRNAWDNPEENFCAAPDKAVAPDFVKFHDHASTLFIKDVAELK

Enzyme Prediction     

No EC number prediction in MGYG000002737_00150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	18	290	7.3e-63	0.8316831683168316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.52e-40	18	281	2	263	Glycosyl hydrolase family 26.
COG4124	ManB2	1.17e-21	109	291	112	299	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS86241.1	4.43e-133	6	355	4	349
AGH13968.1	7.71e-133	23	359	25	357
QNT67784.1	1.12e-132	22	359	28	367
QUB47762.1	4.34e-132	1	351	5	356
QUB85259.1	3.75e-131	23	355	14	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	4.97e-106	28	358	15	342	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	4.65e-75	18	358	35	394	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	4.65e-75	18	358	35	394	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	8.79e-75	18	358	58	417	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	3.66e-74	18	358	35	394	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	8.62e-52	18	358	51	414	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	5.61e-40	58	319	82	360	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	1.26e-24	26	321	48	328	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	1.39e-21	18	324	148	432	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55278	1.77e-21	63	251	77	266	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.999101	0.000163	0.000172	0.000151	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002737_00150.